SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76801745|ref|YP_326753.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801745|ref|YP_326753.1|
Domain Number 1 Region: 381-571
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.53e-71
Family Pyruvate oxidase and decarboxylase PP module 0.0000102
Further Details:      
 
Domain Number 2 Region: 207-372
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.62e-57
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000753
Further Details:      
 
Domain Number 3 Region: 23-197
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.08e-52
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801745|ref|YP_326753.1|
Sequence length 581
Comment acetolactate synthase large subunit [Natronomonas pharaonis DSM 2160]
Sequence
MSGEQTHKPQAETETAAGADDIETGADAVVRALENAGVEHLFGVQGGAIMPVYDALYHSE
MRHITMAHEQGAAHAADAYGIVSGEPGVCMATSGPGATNLVTGIADANMDSDPMLALTGQ
VPTDFVGNDAFQETDTIGVTGPITKANVFADDSEAVGTDVGTAFALANRGRQGPTLVDLP
KDVTKGDATEDPGAPELPDTYEPPETADPEAVSEAADVLAAADKPLILAGGGVIKAEASE
ELREFAIEHEIPVVTTMPGIGCFPEDHELSLEMAGMHGTGYANMAITMTDCMLAVGTRFD
DRLTGGLESFAPDAEVIHVEIDPAEVSKNVEADYPLIGDAKAVTKQLATAMNRSPAADQW
RKQCQEWKTEYPMDYAAPGDDPVKPQYVVERYDEFTDDDTIVTTGVGQHQMWACQYWTYK
EPRTWVSSHGLGTMGYGVPAAIGAKLAAPEKDVVCFDGDGSFLMTCQELSVAVREDLDVT
FVVLNNAAIGMVRQWQDAFFGERHMASEYPWIPEFDTLAEAFGARGFRIDTYEEADDVIQ
ESLDHDGPSVVDVHIDPEENVYPMVPSGGDNGLFALSEDQL
Download sequence
Identical sequences A0A1U7EVW2
WP_011322820.1.57290 gi|76801745|ref|YP_326753.1| 348780.NP2202A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]