SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76801913|ref|YP_326921.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801913|ref|YP_326921.1|
Domain Number 1 Region: 32-373
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.18e-99
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801913|ref|YP_326921.1|
Sequence length 379
Comment 2-oxoacid dehydrogenase E1 component, alpha subunit 2 [Natronomonas pharaonis DSM 2160]
Sequence
MDTADAIDAFAEGENLHRRLDADGQPLVDGYEPPLSDDRLRELHRDMRLARHFDERMVSL
QRQGRIGTYAPLAGQEAAQFGSMYALDDDDWVSYQYREHGAVIDRGGLADYIRYWMGYES
GNATLVEHNIAPLNISIAAHVPHAVGMAWAAKLRGDDRAVVCHFGDGATSEGDFHEGANI
AGVFDVPAVFVCNNNQWAISVPQAAQTASDTFAAKAEAYGFPGVRVDGMDPLATYEVMDE
ALDRAKSDDERPTDAGTASRPSLVEAVQYRFGAHTTADDPSAYRTDEAVERWRRWDPLPR
FEGFLREFGLLDDEAVSAVESDVEATVADAVDQAMAVEPDPDDLFADAYAELPDDIKSQR
AYLQRLREEYGDKALREEH
Download sequence
Identical sequences A0A1U7EWA3
348780.NP2542A gi|76801913|ref|YP_326921.1| WP_011322987.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]