SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76802067|ref|YP_327075.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802067|ref|YP_327075.1|
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.13e-39
Family GHMP Kinase, N-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 188-327
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.29e-31
Family Mevalonate kinase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76802067|ref|YP_327075.1|
Sequence length 329
Comment mevalonate kinase [Natronomonas pharaonis DSM 2160]
Sequence
MTTSSAPGKVYLFGEHAVVYGEPAVPCAIQRRARVTVEERDDDRLQVQANDLTLDGFTVT
WGGETNDRPDVDVPAPLVEAAMGYIDGAIEQALDAVDVEECGFDITVESDIPLGAGLGSS
AAVVVAGIDAAVRELGGELDAQAVAERAYEVEYEVQSGEASRADTFCSAVGGAVRVRGDD
CRRLDDVPTLPFVVGYDGGTGDTGELVAGVRELREEYDFAADTVESIGDIVRKGEAALQR
GDIEEVGRLMDFNHGLLSALGVSARSLDTMVWAAREADALGAKLTGAGGGGCIVALDRTE
QTHTALEYTPGCETAFRAALDTDGVRVEE
Download sequence
Identical sequences A0A1U7EWP0
348780.NP2850A gi|76802067|ref|YP_327075.1| WP_011323141.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]