SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76800779|ref|YP_325787.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800779|ref|YP_325787.1|
Domain Number 1 Region: 96-266
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.85e-24
Family RIO1-like kinases 0.00016
Further Details:      
 
Domain Number 2 Region: 4-90
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.45e-19
Family Rio2 serine protein kinase N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76800779|ref|YP_325787.1|
Sequence length 302
Comment RIO-like serine/threonine protein kinase I [Natronomonas pharaonis DSM 2160]
Sequence
MVQNVATQMAELEEPDFHLLSGIEHGMRFSRWVAEGKLPKFSRLDEEELTYRLDRCMDRE
LIERKTIQYTGYRLTFEGYDALALRTFSERESIDGVGSPLGVGKESDVYEARSFRPLALK
FHREGYTNFREVQKEREYTADNEHRSWFYTARKAAEREYDALETLYPEVSVPRPVDQNRH
AIVMEKVDGVELSRAKLDADQVVGVAELILEEMATAYNAGYVHADMSEYNVFVAADGVTI
FDWPQSVPTEHENSDELLVRDVENLLGHFERKYPSETPAVDERALADALAADEFDSLRAF
EQ
Download sequence
Identical sequences A0A1U7ETI2
WP_011321854.1.57290 gi|76800779|ref|YP_325787.1| 348780.NP0248A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]