SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76800898|ref|YP_325906.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800898|ref|YP_325906.1|
Domain Number 1 Region: 509-714
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 2.88e-59
Family Achaeal helicase C-terminal domain 0.0000299
Further Details:      
 
Domain Number 2 Region: 39-185,221-268,305-400
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-47
Family Tandem AAA-ATPase domain 0.00000623
Further Details:      
 
Domain Number 3 Region: 418-508
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-19
Family RecQ helicase DNA-binding domain-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76800898|ref|YP_325906.1|
Sequence length 747
Comment ski2-like helicase [Natronomonas pharaonis DSM 2160]
Sequence
MDVSEVSGVPPWFADHLREEGIESLYPPQAAAVDAGVADGESLVASVPTASGKTLVAQLA
MLSAIDRGGTALYIVPLRALASEKREEFAAFEEYGLSVGVTTGSYEDTGEWLADKDIIVA
TSEKVDSLVRNGAPWIDDLDCVVADEVHLVDDEHRGPTLEVTLAKLRRVNPNLQVVALSA
TVGNAGEMAEWLDAELVDSSWRPIELRKGVHYGQALHFGDGTQQELPVQRTEKPTEAVVR
ETLDEGGSTLVFVNSRRNAEGAAKRLAKTTVDGLDADERAALSSLAEEIRAVSDTETSDD
LADCVEQGAAFHHAGCSSEHRSLVEDAFRDRLIKTICATPTLAAGVNTPARRVVVRDWRR
YSGDAGGMQPLSVLEVHQMMGRAGRPGRDPYGEAVLLADSHDELDELLDRYVWADPEPVE
SKLAREPSMRTHLLATVASGFADSRSALLSFLDRTLYATQYRHGDGEDNLERVVDTTLSY
LETNGFIDRDGDAIEATDLGHTVSRLYLDPMSAAEIIDGLADAASPTAMGLYQLVARTPD
MYELYLRSGDREEYTMLAYEREAELLGELPSEFEEGRFEDWLSALKTARMLEDWASELDE
DDIAERYGVGPGDIRGKVDTAEWLLGAAESLASEQDLADVSAIREARKRVEHGVGEELID
LAGVRGVGRKRARRLYDAGIETRADLRNADKSVVLAALRGREQTAENVLEAAGHQQPEMD
GVTPDADVKESAAAAGTDDGQANLGDF
Download sequence
Identical sequences Q3IU46
gi|76800898|ref|YP_325906.1| 348780.NP0492A WP_011321973.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]