SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76800989|ref|YP_325997.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800989|ref|YP_325997.1|
Domain Number 1 Region: 10-83
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000327
Family MarR-like transcriptional regulators 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76800989|ref|YP_325997.1|
Sequence length 93
Comment transcription regulator [Natronomonas pharaonis DSM 2160]
Sequence
MADSDGEALADLPPSAKLVYKVLEYNGAMTQKDIVEESMLSARTVRYALERLEDIDIVSE
DVYFADARQNLYELTDEAEAVTDGAADPAACDD
Download sequence
Identical sequences A0A1U7EU04
gi|76800989|ref|YP_325997.1| 348780.NP0674A WP_011322064.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]