SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76801000|ref|YP_326008.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801000|ref|YP_326008.1|
Domain Number 1 Region: 230-488
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.67e-56
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000471
Further Details:      
 
Domain Number 2 Region: 3-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000321
Family MarR-like transcriptional regulators 0.034
Further Details:      
 
Weak hits

Sequence:  gi|76801000|ref|YP_326008.1|
Domain Number - Region: 162-202
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0355
Family MarR-like transcriptional regulators 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76801000|ref|YP_326008.1|
Sequence length 504
Comment phenylalanyl-tRNA synthetase subunit alpha [Natronomonas pharaonis DSM 2160]
Sequence
MRLPETQLALLEAASATETKTVAQLAEALGEDPAAVTRAAFELETEGLVAVEEHVAEEVA
VTEEGDRYRDDGLPEVRLYRAAVDAGADEEPVELGRLLGSAALDGPEVDIALSNFARKGY
GHIDSGKVDAAPDPTHDPNADPEAEALDAIANDNAGYLDAEVLDRLESRGLIERTETTVR
SVTLTDDGVTALMEGIETAETVGAVTPELLASGEWEDVEFAEYNVEADAEPVNGGKEHIL
RQTANRVKDVLVGMGFQEMEGPHADADFWINDCLFMPQDHPARTHWDRFALDVPGMDELP
ADLVERVEDAHRNGVGSEGDGYHSPWDEDFARAVALRGHTTSLSMRYLSGHAVGDLEPPQ
RYFSVEKVYRNDTLDPTHLLEFYQIEGWVMAEDLSVRDLMGTFTEFYEQFGITDLQFKPH
YNPYTEPSFELFGEHPETGELIEIGNSGIFREEVLSPLGVDCDVMAWGLALERLLMLMYG
FEDIRDVHGTLCDLELLRDVEVVQ
Download sequence
Identical sequences A0A1U7EU14
WP_011322075.1.57290 gi|76801000|ref|YP_326008.1| 348780.NP0696A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]