SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76801407|ref|YP_326415.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801407|ref|YP_326415.1|
Domain Number 1 Region: 57-136
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000796
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801407|ref|YP_326415.1|
Sequence length 137
Comment hypothetical protein NP1514A [Natronomonas pharaonis DSM 2160]
Sequence
MTPVEHDGNRYLLRKQSTESSLVYDPETGDERYLPNDELTEVGDSPLSVAAESVPEAARR
VLVAVHSDETLGLLVELDERGPLPARELLGRYGLCESDLHGRTAELRAAGLVATADIDGE
RGYAITDAGRDGLDVLR
Download sequence
Identical sequences A0A1U7EV15
gi|76801407|ref|YP_326415.1| 348780.NP1514A WP_011322482.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]