SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76801411|ref|YP_326419.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801411|ref|YP_326419.1|
Domain Number 1 Region: 19-83
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000025
Family RPO3F domain-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76801411|ref|YP_326419.1|
Sequence length 111
Comment transcription regulator [Natronomonas pharaonis DSM 2160]
Sequence
MSATDTKAVESDGWEAVAELPPSAKLVAKVLEYNDRLTQSQLAEETMLPPRTVRYGLNRL
EEVDAVDSRFSFTDARKRVYTLAVEDEAKQDGTRGTKRDGTRSGSVLPADD
Download sequence
Identical sequences A0A1U7EV10
348780.NP1522A gi|76801411|ref|YP_326419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]