SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76801414|ref|YP_326422.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801414|ref|YP_326422.1|
Domain Number 1 Region: 12-77
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000423
Family PF1790-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801414|ref|YP_326422.1|
Sequence length 101
Comment hypothetical protein NP1528A [Natronomonas pharaonis DSM 2160]
Sequence
MIDRLEKEVDMLERHLRVLRMVIENEPIGIVKMSNETGYPHHKVRYSLRVLEEENLIEPS
SQGAITTEDTIEFVEDLDSKVDDIIDKLEGMKIDDVPEIEG
Download sequence
Identical sequences A0A1U7EV38
WP_011322489.1.57290 gi|76801414|ref|YP_326422.1| 348780.NP1528A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]