SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76801888|ref|YP_326896.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801888|ref|YP_326896.1|
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.58e-23
Family PF1790-like 0.0024
Further Details:      
 
Domain Number 2 Region: 216-261
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000108
Family LexA repressor, N-terminal DNA-binding domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801888|ref|YP_326896.1|
Sequence length 265
Comment hypothetical protein NP2490A [Natronomonas pharaonis DSM 2160]
Sequence
MDSAALLDLLGNENRRRILRLLARRPCYVTEISDYLGVSPKAVIDHLRKLEEAGLVESHV
DDGRRKYFSIARNLRLEVNVTPYDFGTKSAYSASPNLDITSWKHVSLHVERATQAAAELN
SEEETEDTDIRTDAAGASDSPPADVADGASDSDSPGDADQPPNADLAGLAADLEQLERLE
NELSMAQRWVQGRLTETLDRISDHFDGVDGRFYAELLRGLATGPEPPDRLAQRVDAPPDV
VADALEGLAAHGVVERDGDQWRLNV
Download sequence
Identical sequences A0A1U7EW74
WP_011322962.1.57290 gi|76801888|ref|YP_326896.1| 348780.NP2490A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]