SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76802005|ref|YP_327013.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802005|ref|YP_327013.1|
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.4e-38
Family Pyruvate oxidase and decarboxylase Pyr module 0.0023
Further Details:      
 
Domain Number 2 Region: 403-572
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.43e-24
Family Pyruvate oxidase and decarboxylase PP module 0.0052
Further Details:      
 
Domain Number 3 Region: 167-177,224-376
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0000000244
Family Pyruvate oxidase and decarboxylase, middle domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76802005|ref|YP_327013.1|
Sequence length 586
Comment 2-oxoglutarate decarboxylase; 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Natronomonas pharaonis DSM 2160]
Sequence
MATPNVNTLWGQTVADELATVGIETAVLAPGSRSTPLAVAFAQHDDIEAVSLLDERSAAF
FALGYAKRTGQPAPLVCTSGTALANFHPAVIEADTARVPMVLLTADRPPELADSGANQTI
DQADLYGDAVRSYRTLPEPEAAARKLRSLRTTLCRAVGTATGTEPGPVHLNVPFRKPLEP
LAAAEPPAGVPDGAVPDGFATENPLAARGRDGPFVEVHSGCTDPSATTVDELATAVEAAA
SGLIVCGPTDRPAPDAESLVALADATGFSVFADPLSGLRFGPHVDDAPVCGGYDAYLPAL
EQTPEVVIRFGASPTSKPLRQYLRDADARQFIVDPAGGWREATFTATDLVVADETRLATA
VADAVDRTPGSYADRLAELEPGYWRLVEGEEPQEGAMLADAVALAPDPSTVFVSNSMPVR
DLDRFGAPQAASLSVLGNRGASGIDGIASTALGAGFGTDDPLVAVTGDLAYYHDMNGLLA
VSRAGVDATIVCINNDGGGIFHVLPIEAHESFDKWFRTPHGLDFEPSAALYDIEFARTDS
REGFRSLYSEAVGSGETQVIEVQTESGHNHADRTALREAVVEELGR
Download sequence
Identical sequences Q3IQZ0
WP_011323079.1.57290 gi|76802005|ref|YP_327013.1| 348780.NP2726A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]