SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76802188|ref|YP_327196.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802188|ref|YP_327196.1|
Domain Number 1 Region: 13-285
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.4e-38
Family Extended AAA-ATPase domain 0.0017
Further Details:      
 
Domain Number 2 Region: 292-391
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000218
Family TrmB-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76802188|ref|YP_327196.1|
Sequence length 398
Comment cell division control protein cdc6-like protein [Natronomonas pharaonis DSM 2160]
Sequence
MTEDLFSEMTETLFEDKSILSEEYRPDVIVERDDEIDAYRTALKDVLFGRNPSNVFIYGK
TGVGKTAVTEYIMNALQTEVSRRDAADELHVHFRNCNGDTVYRTVRALVNSIRGHNREKF
PETGLSTSHALETLYEEMDSLGGTFLFVLDEIDHLSDPNTLLYELPRARSNGHLENARVG
VIGISNNYTFRSSLSPKVKDTLMEKEIAFSPYDAGELQSILTARAEKALVDGACEESAIR
LAAAKAAKDTGSARQAIDLLREGGDVAEEHGAEAITDSHIEVASERVQRGRVQNKLRDQT
MHGQLILEAIARLEADGEAPVRSKEVQDSYERVAGRWSRDPLTTLKSIQNHLADLTMLGF
LERTEQNEGRAGGVHYQYELTLDPEIVLETRASIETDA
Download sequence
Identical sequences A0A1U7EWZ3
WP_011323261.1.57290 348780.NP3096A gi|76802188|ref|YP_327196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]