SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76802203|ref|YP_327211.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802203|ref|YP_327211.1|
Domain Number 1 Region: 11-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000491
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76802203|ref|YP_327211.1|
Sequence length 86
Comment transcription regulator [Natronomonas pharaonis DSM 2160]
Sequence
MSDHDAAVEPLPPSAKLVYKTLEYEGPMSQSQLADASLLPQRTVRHALRKLDAAGVVEES
VCLMDARKSTYELREPESSDPDTVTA
Download sequence
Identical sequences A0A1U7EX23
gi|76802203|ref|YP_327211.1| 348780.NP3126A WP_011323276.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]