SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76802235|ref|YP_327243.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802235|ref|YP_327243.1|
Domain Number 1 Region: 5-202,270-295
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.57e-59
Family Creatinase/aminopeptidase 0.00000632
Further Details:      
 
Domain Number 2 Region: 199-270
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000326
Family Methionine aminopeptidase, insert domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76802235|ref|YP_327243.1|
Sequence length 297
Comment methionine aminopeptidase [Natronomonas pharaonis DSM 2160]
Sequence
MSVDLSDEKFEKHREAGEILAQVREEAAERVEVGVSHLDVAEYAEERIRELGGEPAFPVN
ISIDEEAAHATPAPDDESEFGEEMVNLDIGVHVDGWLADTAVTVDLSGNAELAEASAEAL
EAAIDVVEPGVHTGEIGAEIESVIDGYGYNPVVNLSGHGLGHWEQHTEPNIPNRGVQQGV
ELEVGDVVAIEPFATDGGGKVSEGATEEIYALEREASVRDRGARQALEQIVEEFKTLPFA
RRWLETSRAEMALRRLKQKNVVHGYPVLKEEDGCLVSQKEHTVLVTEDGCEVTTRPR
Download sequence
Identical sequences A0A1U7EX61
WP_011323308.1.57290 gi|76802235|ref|YP_327243.1| 348780.NP3190A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]