SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76802383|ref|YP_327391.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802383|ref|YP_327391.1|
Domain Number 1 Region: 119-177
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000623
Family Iron-dependent repressor protein 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76802383|ref|YP_327391.1|
Sequence length 187
Comment hypothetical protein NP3490A [Natronomonas pharaonis DSM 2160]
Sequence
MFPNALRDGRLVAAALLVVSTFALGVQLLNPPELVVAGGDDAALETVGYYFRYRDAIVVA
VSAAVFGASAAFLALDAYPSDSEEKRSLETAVADSPEAGTSDGPGASESADETARRTRWE
ETAARLADTERIVYETALEADGEIAQREIVERTDLSKATVSRTLSNLESRGLLDRERRGM
GNVVVLQ
Download sequence
Identical sequences A0A1U7EXE8
gi|76802383|ref|YP_327391.1| WP_011323456.1.57290 348780.NP3490A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]