SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76802537|ref|YP_327545.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76802537|ref|YP_327545.1|
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000317
Family HxlR-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76802537|ref|YP_327545.1|
Sequence length 255
Comment hypothetical protein NP3804A [Natronomonas pharaonis DSM 2160]
Sequence
MEFLARSGNRIAVLEAVSERPHTRSELAERTGASQATLGRILRDFEERNWLARTDGAYVA
TPTGNLVADGVLDLRKRLETERRLRPVVGMLPDELDVDLRRLRTATLTTPTETRPSAPVT
RSLDILREAGHIRAVSRALNDRTLRLLRRRAVADGCTVDGVFAARAIEALVDDDRLRPKL
RELVAAESADIHVYEGPLSLAVTLADGTVSLLLRDDDGVVQAALDTDDEAVAEWAASVHE
QHRTAAEPLSPADIV
Download sequence
Identical sequences 348780.NP3804A gi|76802537|ref|YP_327545.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]