SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76803308|ref|YP_331403.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803308|ref|YP_331403.1|
Domain Number 1 Region: 19-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000256
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76803308|ref|YP_331403.1|
Sequence length 99
Comment hypothetical protein NP5362A [Natronomonas pharaonis DSM 2160]
Sequence
MSDRQHRHPAEWMCMLDERILEHLEREGWSTASLIEQATTMNASESRTRERLRMLTDCGL
VAPIFEGSRMYELTSEGQRYLRGELDAKKHIEQPNPHAV
Download sequence
Identical sequences A0A1U7EZL7
gi|76803308|ref|YP_331403.1| WP_011324380.1.57290 348780.NP5362A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]