SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76803389|ref|YP_327658.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803389|ref|YP_327658.1|
Domain Number 1 Region: 104-218
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00000000000207
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.016
Further Details:      
 
Domain Number 2 Region: 31-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000421
Family Hypothetical protein PH1932 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76803389|ref|YP_327658.1|
Sequence length 229
Comment hypothetical protein NP6048A [Natronomonas pharaonis DSM 2160]
Sequence
MSEMAKQDIRICIDAYPGPDTDVFRISAADNILRLLADAHETEFTIPELVDATGVTRSTV
WRAVDLLNSIGAIQIRETPQRNYISINPDRLQKDDPILGIPQSEFHAPIRAFVDRVQATT
ADADDINDLLGIVVFGSVARGEADRQSDIDCFVVVDGDRTTARRQITDVVADLQSERFDG
DRFVFEPYVESVESAGRAGSKLHEIFTEGITVYRSDRLDALRKEVVADE
Download sequence
Identical sequences Q3IM57
348780.NP6048A gi|76803389|ref|YP_327658.1|NC_007427 gi|76803389|ref|YP_327658.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]