SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76803392|ref|YP_327661.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803392|ref|YP_327661.1|
Domain Number 1 Region: 42-122
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.06e-19
Family ArsR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76803392|ref|YP_327661.1|
Sequence length 133
Comment transcription regulator [Natronomonas pharaonis DSM 2160]
Sequence
MAQTTERLQRYLSDELGECCSEDVEQRLNELETLGDALATEQIASELDVLSALANETRYT
IIRVLVAAEEELCVCELNAVVDVTESGLSHALSQLVDADLVDGRKDGRWKKYRATNRAVA
LVTLLEGSVSTDA
Download sequence
Identical sequences Q3IM54
WP_011324413.1.57290 348780.NP6056A gi|76803392|ref|YP_327661.1| gi|76803392|ref|YP_327661.1|NC_007427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]