SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76803479|ref|YP_327748.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803479|ref|YP_327748.1|
Domain Number 1 Region: 2-241
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.39e-35
Family Extended AAA-ATPase domain 0.0087
Further Details:      
 
Domain Number 2 Region: 238-318
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000024
Family MarR-like transcriptional regulators 0.062
Further Details:      
 
Weak hits

Sequence:  gi|76803479|ref|YP_327748.1|
Domain Number - Region: 371-442
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.000225
Family MRR-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76803479|ref|YP_327748.1|
Sequence length 463
Comment hypothetical protein NP6246A [Natronomonas pharaonis DSM 2160]
Sequence
MTFYDREAELDTLSDAVESPGADFVVVYGRRRVGKTELLKEFCANRPHIYFLAAQEAEHR
QREKFLDQVADYFDERVPRIDGWDEAFEYLGEQLQREDLVVVIDEFPYLVAENDSLPSYV
QGFVDQELDGTDSMIVLCGSSVSTMESEILGHESPLYGRRTAQLDVTPFSFQQAREVISY
DIQDAIRSYAVTGGTPMYLTLFDYTQSLAANIQSHVLSPSAVLYNEPEFLLRTELRNPAR
YMSILEAVALGHTTPNEISGATGIDSGPLSKYLQTLRRLRLIERDVPVMASGKKSKRSRY
RVADEFLRFWFRYVEPNRSSIEEAPEIVYDGTIEPDLPTHVATTFEDVCQEAVWEGIRRG
TFDPYSEVGRWWYGEEEIDIVGLAPNDDRVLLAECKWTTDPVGEDLVESLRAKAEHVRWG
PPDRDEQFALFSKSGFVDGLEAQLDDSWSLFTVADIDDLLTPS
Download sequence
Identical sequences Q3ILW7
WP_011324500.1.57290 348780.NP6246A NpR82 gi|76803479|ref|YP_327748.1| gi|76803479|ref|YP_327748.1|NC_007427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]