SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pa_1_11490|chrm1_SC2|Putative from Podospora anserina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pa_1_11490|chrm1_SC2|Putative
Domain Number 1 Region: 91-302
Classification Level Classification E-value
Superfamily ITPase-like 1.77e-42
Family Maf-like 0.0000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pa_1_11490|chrm1_SC2|Putative
Sequence length 323
Comment protein similar to Protein C3G6.03c of Schizosaccharomyces pombe
Sequence
MNLTPFRRPATLLLYLSRHFTTTTTTCSLKHPPPPPFPSTINAMDLTSPPPEEPPSYIAA
ARSHGIPLRQSAPIKPGPLPLQLPILNHLRTKRVILASASPRRRAMLNQIGLTNLEVWPS
NTPEDLDKKTHSPEEYVSATARAKCHAVYEAVLAAQAKPDATKEHLEDPAVVIAADTIIA
TRAGQILEKPKNEQDHVRMLTHLRDGRYHRVLTGVCVMAPKADASHPGYEIRGHVEDTKV
YFAREEDGLPDDVIERYVRTREGGDKAGGDARQGAGPLALVEKVEGSVDNVIGLPVRKCL
QLCERVVFRQGEVVVGEEEDEEE
Download sequence
Identical sequences Pa_1_11490|chrm1_SC2|Putative

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]