SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pa_1_24520|chrm1_SC6|Putative from Podospora anserina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pa_1_24520|chrm1_SC6|Putative
Domain Number 1 Region: 11-173
Classification Level Classification E-value
Superfamily CinA-like 4.05e-43
Family CinA-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pa_1_24520|chrm1_SC6|Putative
Sequence length 178
Comment protein of unknown function
Sequence
MSAFLARSTETLLDIAADVIQLLKSSNATVGVAESLTAGGVMVALTSVPGASAAFLGGVV
SYATPLKQTLLSVDATLIAKEGVIHEEVASQMAEGARRITTHDDAPPTTWGVGTTGVAGP
DKQDGKAVGTVYIGIASPTGSKAFGPFNFPGTRERIREATVMEALARLREELMKARQA
Download sequence
Identical sequences B2ASS6
Pa_1_24520|chrm1_SC6|Putative XP_001906778.1.27508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]