SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pa_2_5430|chrm2_SC2|Putative from Podospora anserina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pa_2_5430|chrm2_SC2|Putative
Domain Number 1 Region: 41-220
Classification Level Classification E-value
Superfamily ITPase-like 4.71e-59
Family ITPase (Ham1) 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pa_2_5430|chrm2_SC2|Putative
Sequence length 224
Comment inosine triphosphate pyrophosphatase
Sequence
MSNDLSHRSTSQPNPVTHTNSFSSHFHSQGLPQTAKMTEARHQVNFITGNANKLSEVKAI
LEPAISVTNQSLDLVEIQGTLEEVTIDKCRRAAELVGGPVLVEDTCLCFDALQDLPGPYI
KWFLGSIGHEGLNNMLLAYEDKGAKAVCTFGYSAGPGHEPILFQGITHGKIVPARGPSNF
GWDPIFEYEGKTYAEMDKAEKNKISHRSRALAKLQEWFAKEMTA
Download sequence
Identical sequences Pa_2_5430|chrm2_SC2|Putative XP_001911303.1.27508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]