SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|521211829|ref|YP_008168175.1| from Staphylococcus aureus Bmb9393

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521211829|ref|YP_008168175.1|
Domain Number 1 Region: 35-353
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.96e-90
Family Phosphate binding protein-like 0.000000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|521211829|ref|YP_008168175.1|
Sequence length 357
Comment Spermidine/putrescine-binding periplasmic protein [Staphylococcus aureus Bmb9393]
Sequence
MKRFLQLIIGALVVGMLCLTLSHWFKSKEQVHTNQKIYVYNWGEYIDPELIKKFEKETGI
QVVYETFDSNEAMEAKIRNGGTHYDVAFPSEYTVQKLKRDHLLLPIDHNKVPNIKNLDSD
YMNMSFDRGNKYSLPYFFGTVGILYNKEKYPNESFDSWKSLYNPKFKNQILLVDGAREII
GMSLNKLGYNLNDRNSHHLKEAERDLTKLAPQVRGVVGDEITMMLQQNEGNIAVVWSGVA
APLVQEGDKYNYVIPKEGSNLWFDNMVIPKTAQNKEGAYKFMNFLLDAKNNKQNTEFVGY
ATPNKAARQLLPKEIKDDHRFYPTKKEQERLEVYKDLGPEVLSEYNENFLNFKMSLK
Download sequence
Identical sequences A0A0E1AH22 A0A0H2WYM5 A0A0H2XGL3 A0A0H3JVX9 A0A0H3K802 A0A1E8WQ38 A0A2K1ACA8 Q2G2A8 X5E203
gi|87160442|ref|YP_493700.1| gi|88194801|ref|YP_499598.1| gi|521211829|ref|YP_008168175.1| gi|21282714|ref|NP_645802.1| gi|384861697|ref|YP_005744417.1| gi|151221180|ref|YP_001332002.1| gi|384869635|ref|YP_005752349.1| WP_000819690.1.100013 WP_000819690.1.100041 WP_000819690.1.100049 WP_000819690.1.100057 WP_000819690.1.10006 WP_000819690.1.100067 WP_000819690.1.100072 WP_000819690.1.100088 WP_000819690.1.100090 WP_000819690.1.100094 WP_000819690.1.100154 WP_000819690.1.100180 WP_000819690.1.100189 WP_000819690.1.100298 WP_000819690.1.100307 WP_000819690.1.100335 WP_000819690.1.100352 WP_000819690.1.100391 WP_000819690.1.10041 WP_000819690.1.100618 WP_000819690.1.100631 WP_000819690.1.100647 WP_000819690.1.100761 WP_000819690.1.100834 WP_000819690.1.100903 WP_000819690.1.100920 WP_000819690.1.100963 WP_000819690.1.100981 WP_000819690.1.100987 WP_000819690.1.101017 WP_000819690.1.101084 WP_000819690.1.101177 WP_000819690.1.101240 WP_000819690.1.101266 WP_000819690.1.101327 WP_000819690.1.101329 WP_000819690.1.101330 WP_000819690.1.101375 WP_000819690.1.101393 WP_000819690.1.101406 WP_000819690.1.101490 WP_000819690.1.101511 WP_000819690.1.101566 WP_000819690.1.101570 WP_000819690.1.101598 WP_000819690.1.101615 WP_000819690.1.10166 WP_000819690.1.101725 WP_000819690.1.101757 WP_000819690.1.101788 WP_000819690.1.101950 WP_000819690.1.102066 WP_000819690.1.1022 WP_000819690.1.10232 WP_000819690.1.10397 WP_000819690.1.10431 WP_000819690.1.10486 WP_000819690.1.10503 WP_000819690.1.1052 WP_000819690.1.10542 WP_000819690.1.10543 WP_000819690.1.10565 WP_000819690.1.10614 WP_000819690.1.10679 WP_000819690.1.10707 WP_000819690.1.10726 WP_000819690.1.10742 WP_000819690.1.1087 WP_000819690.1.10950 WP_000819690.1.10985 WP_000819690.1.11129 WP_000819690.1.1120 WP_000819690.1.11228 WP_000819690.1.11287 WP_000819690.1.11294 WP_000819690.1.11348 WP_000819690.1.11353 WP_000819690.1.1136 WP_000819690.1.11377 WP_000819690.1.11407 WP_000819690.1.11488 WP_000819690.1.11492 WP_000819690.1.11525 WP_000819690.1.11558 WP_000819690.1.11571 WP_000819690.1.11592 WP_000819690.1.11655 WP_000819690.1.11665 WP_000819690.1.11692 WP_000819690.1.117 WP_000819690.1.11719 WP_000819690.1.11720 WP_000819690.1.11795 WP_000819690.1.11829 WP_000819690.1.11991 WP_000819690.1.12005 WP_000819690.1.1205 WP_000819690.1.12073 WP_000819690.1.12098 WP_000819690.1.12123 WP_000819690.1.12179 WP_000819690.1.12181 WP_000819690.1.12233 WP_000819690.1.12297 WP_000819690.1.12328 WP_000819690.1.12366 WP_000819690.1.12436 WP_000819690.1.12447 WP_000819690.1.12498 WP_000819690.1.12639 WP_000819690.1.12715 WP_000819690.1.12771 WP_000819690.1.12822 WP_000819690.1.12833 WP_000819690.1.12845 WP_000819690.1.12862 WP_000819690.1.12903 WP_000819690.1.12937 WP_000819690.1.12938 WP_000819690.1.13039 WP_000819690.1.13091 WP_000819690.1.13104 WP_000819690.1.13322 WP_000819690.1.1347 WP_000819690.1.13486 WP_000819690.1.13531 WP_000819690.1.1355 WP_000819690.1.13556 WP_000819690.1.13568 WP_000819690.1.13617 WP_000819690.1.13650 WP_000819690.1.13654 WP_000819690.1.13683 WP_000819690.1.13727 WP_000819690.1.1374 WP_000819690.1.13755 WP_000819690.1.13757 WP_000819690.1.13772 WP_000819690.1.13804 WP_000819690.1.13805 WP_000819690.1.13914 WP_000819690.1.13940 WP_000819690.1.13983 WP_000819690.1.14071 WP_000819690.1.14112 WP_000819690.1.14153 WP_000819690.1.14233 WP_000819690.1.1426 WP_000819690.1.14364 WP_000819690.1.14365 WP_000819690.1.14366 WP_000819690.1.14394 WP_000819690.1.14418 WP_000819690.1.14475 WP_000819690.1.1457 WP_000819690.1.14590 WP_000819690.1.147 WP_000819690.1.14744 WP_000819690.1.1477 WP_000819690.1.14790 WP_000819690.1.14809 WP_000819690.1.14869 WP_000819690.1.14888 WP_000819690.1.14902 WP_000819690.1.14987 WP_000819690.1.15000 WP_000819690.1.15091 WP_000819690.1.15228 WP_000819690.1.15241 WP_000819690.1.15263 WP_000819690.1.15278 WP_000819690.1.15329 WP_000819690.1.15399 WP_000819690.1.15409 WP_000819690.1.15438 WP_000819690.1.1545 WP_000819690.1.15489 WP_000819690.1.15505 WP_000819690.1.15524 WP_000819690.1.15572 WP_000819690.1.15601 WP_000819690.1.15687 WP_000819690.1.1569 WP_000819690.1.15706 WP_000819690.1.15753 WP_000819690.1.1579 WP_000819690.1.15818 WP_000819690.1.1583 WP_000819690.1.15838 WP_000819690.1.15883 WP_000819690.1.15892 WP_000819690.1.15897 WP_000819690.1.15898 WP_000819690.1.15928 WP_000819690.1.15957 WP_000819690.1.15972 WP_000819690.1.1600 WP_000819690.1.1606 WP_000819690.1.16112 WP_000819690.1.16213 WP_000819690.1.16237 WP_000819690.1.16362 WP_000819690.1.16417 WP_000819690.1.16554 WP_000819690.1.16569 WP_000819690.1.16603 WP_000819690.1.16617 WP_000819690.1.16628 WP_000819690.1.16672 WP_000819690.1.16679 WP_000819690.1.16688 WP_000819690.1.16703 WP_000819690.1.16757 WP_000819690.1.16768 WP_000819690.1.16770 WP_000819690.1.16776 WP_000819690.1.16892 WP_000819690.1.16946 WP_000819690.1.170 WP_000819690.1.17012 WP_000819690.1.17038 WP_000819690.1.17050 WP_000819690.1.17104 WP_000819690.1.17137 WP_000819690.1.17169 WP_000819690.1.17210 WP_000819690.1.17231 WP_000819690.1.17234 WP_000819690.1.17249 WP_000819690.1.1725 WP_000819690.1.17256 WP_000819690.1.17320 WP_000819690.1.17450 WP_000819690.1.17485 WP_000819690.1.17520 WP_000819690.1.17581 WP_000819690.1.17650 WP_000819690.1.17657 WP_000819690.1.17666 WP_000819690.1.17729 WP_000819690.1.17770 WP_000819690.1.17834 WP_000819690.1.17845 WP_000819690.1.17859 WP_000819690.1.17876 WP_000819690.1.17929 WP_000819690.1.17951 WP_000819690.1.18016 WP_000819690.1.18035 WP_000819690.1.18074 WP_000819690.1.18105 WP_000819690.1.18197 WP_000819690.1.18283 WP_000819690.1.18290 WP_000819690.1.18320 WP_000819690.1.18346 WP_000819690.1.1835 WP_000819690.1.18437 WP_000819690.1.18451 WP_000819690.1.1851 WP_000819690.1.18516 WP_000819690.1.18529 WP_000819690.1.18538 WP_000819690.1.18562 WP_000819690.1.18567 WP_000819690.1.18611 WP_000819690.1.18627 WP_000819690.1.18658 WP_000819690.1.18668 WP_000819690.1.18758 WP_000819690.1.18809 WP_000819690.1.18830 WP_000819690.1.18836 WP_000819690.1.18879 WP_000819690.1.18918 WP_000819690.1.18938 WP_000819690.1.1901 WP_000819690.1.19022 WP_000819690.1.19027 WP_000819690.1.19149 WP_000819690.1.19179 WP_000819690.1.192 WP_000819690.1.19272 WP_000819690.1.19390 WP_000819690.1.19411 WP_000819690.1.19444 WP_000819690.1.19509 WP_000819690.1.19653 WP_000819690.1.19733 WP_000819690.1.1975 WP_000819690.1.19765 WP_000819690.1.19775 WP_000819690.1.19807 WP_000819690.1.19853 WP_000819690.1.20057 WP_000819690.1.20101 WP_000819690.1.2013 WP_000819690.1.20155 WP_000819690.1.20160 WP_000819690.1.20210 WP_000819690.1.20235 WP_000819690.1.20265 WP_000819690.1.20354 WP_000819690.1.20386 WP_000819690.1.20473 WP_000819690.1.20554 WP_000819690.1.20690 WP_000819690.1.20772 WP_000819690.1.20833 WP_000819690.1.20838 WP_000819690.1.20860 WP_000819690.1.20975 WP_000819690.1.21013 WP_000819690.1.21054 WP_000819690.1.21080 WP_000819690.1.21081 WP_000819690.1.2128 WP_000819690.1.21312 WP_000819690.1.21330 WP_000819690.1.21356 WP_000819690.1.21386 WP_000819690.1.21465 WP_000819690.1.21511 WP_000819690.1.2154 WP_000819690.1.21583 WP_000819690.1.21601 WP_000819690.1.21679 WP_000819690.1.21712 WP_000819690.1.21820 WP_000819690.1.21890 WP_000819690.1.21901 WP_000819690.1.22045 WP_000819690.1.22149 WP_000819690.1.22163 WP_000819690.1.22165 WP_000819690.1.22170 WP_000819690.1.22174 WP_000819690.1.22246 WP_000819690.1.22332 WP_000819690.1.22344 WP_000819690.1.22351 WP_000819690.1.22367 WP_000819690.1.22526 WP_000819690.1.22531 WP_000819690.1.22551 WP_000819690.1.22657 WP_000819690.1.22730 WP_000819690.1.22731 WP_000819690.1.2280 WP_000819690.1.22811 WP_000819690.1.22843 WP_000819690.1.22859 WP_000819690.1.22994 WP_000819690.1.23004 WP_000819690.1.23152 WP_000819690.1.23228 WP_000819690.1.23238 WP_000819690.1.23381 WP_000819690.1.23450 WP_000819690.1.23489 WP_000819690.1.23491 WP_000819690.1.23541 WP_000819690.1.23544 WP_000819690.1.23586 WP_000819690.1.23613 WP_000819690.1.23626 WP_000819690.1.2365 WP_000819690.1.23822 WP_000819690.1.23849 WP_000819690.1.23907 WP_000819690.1.23935 WP_000819690.1.23944 WP_000819690.1.23998 WP_000819690.1.24148 WP_000819690.1.24167 WP_000819690.1.2423 WP_000819690.1.24241 WP_000819690.1.24279 WP_000819690.1.2434 WP_000819690.1.24364 WP_000819690.1.24418 WP_000819690.1.2442 WP_000819690.1.24443 WP_000819690.1.24462 WP_000819690.1.24478 WP_000819690.1.24503 WP_000819690.1.2458 WP_000819690.1.24617 WP_000819690.1.24684 WP_000819690.1.24745 WP_000819690.1.24781 WP_000819690.1.2480 WP_000819690.1.24802 WP_000819690.1.24891 WP_000819690.1.24903 WP_000819690.1.25083 WP_000819690.1.25120 WP_000819690.1.25170 WP_000819690.1.25438 WP_000819690.1.25469 WP_000819690.1.25479 WP_000819690.1.25511 WP_000819690.1.25567 WP_000819690.1.25593 WP_000819690.1.25634 WP_000819690.1.25737 WP_000819690.1.25770 WP_000819690.1.2579 WP_000819690.1.25820 WP_000819690.1.25867 WP_000819690.1.25868 WP_000819690.1.25881 WP_000819690.1.25891 WP_000819690.1.25924 WP_000819690.1.2593 WP_000819690.1.26006 WP_000819690.1.26015 WP_000819690.1.262 WP_000819690.1.26293 WP_000819690.1.26307 WP_000819690.1.2633 WP_000819690.1.26346 WP_000819690.1.26370 WP_000819690.1.26405 WP_000819690.1.26481 WP_000819690.1.2656 WP_000819690.1.2658 WP_000819690.1.2661 WP_000819690.1.26626 WP_000819690.1.2664 WP_000819690.1.26663 WP_000819690.1.26733 WP_000819690.1.26771 WP_000819690.1.26790 WP_000819690.1.26927 WP_000819690.1.26958 WP_000819690.1.27042 WP_000819690.1.27154 WP_000819690.1.2718 WP_000819690.1.27246 WP_000819690.1.27311 WP_000819690.1.27333 WP_000819690.1.2734 WP_000819690.1.27345 WP_000819690.1.27455 WP_000819690.1.27457 WP_000819690.1.27551 WP_000819690.1.27562 WP_000819690.1.2759 WP_000819690.1.27608 WP_000819690.1.27614 WP_000819690.1.27615 WP_000819690.1.27621 WP_000819690.1.27654 WP_000819690.1.27670 WP_000819690.1.2768 WP_000819690.1.27717 WP_000819690.1.27748 WP_000819690.1.27817 WP_000819690.1.27854 WP_000819690.1.27950 WP_000819690.1.27953 WP_000819690.1.27972 WP_000819690.1.28007 WP_000819690.1.28025 WP_000819690.1.28063 WP_000819690.1.28071 WP_000819690.1.28088 WP_000819690.1.28117 WP_000819690.1.28138 WP_000819690.1.28147 WP_000819690.1.28158 WP_000819690.1.28191 WP_000819690.1.28207 WP_000819690.1.28334 WP_000819690.1.28358 WP_000819690.1.28360 WP_000819690.1.28376 WP_000819690.1.28381 WP_000819690.1.28477 WP_000819690.1.28498 WP_000819690.1.28502 WP_000819690.1.28527 WP_000819690.1.28532 WP_000819690.1.28629 WP_000819690.1.28650 WP_000819690.1.28675 WP_000819690.1.28710 WP_000819690.1.28725 WP_000819690.1.28862 WP_000819690.1.28866 WP_000819690.1.28887 WP_000819690.1.28915 WP_000819690.1.28933 WP_000819690.1.28960 WP_000819690.1.28970 WP_000819690.1.29090 WP_000819690.1.29107 WP_000819690.1.29188 WP_000819690.1.29207 WP_000819690.1.29243 WP_000819690.1.29272 WP_000819690.1.29282 WP_000819690.1.29285 WP_000819690.1.29312 WP_000819690.1.29315 WP_000819690.1.29372 WP_000819690.1.29373 WP_000819690.1.29381 WP_000819690.1.29511 WP_000819690.1.29541 WP_000819690.1.29561 WP_000819690.1.29596 WP_000819690.1.29644 WP_000819690.1.29676 WP_000819690.1.29716 WP_000819690.1.2975 WP_000819690.1.29758 WP_000819690.1.29781 WP_000819690.1.29805 WP_000819690.1.29885 WP_000819690.1.29963 WP_000819690.1.30012 WP_000819690.1.30023 WP_000819690.1.30033 WP_000819690.1.30047 WP_000819690.1.30057 WP_000819690.1.30154 WP_000819690.1.30176 WP_000819690.1.30274 WP_000819690.1.30333 WP_000819690.1.30367 WP_000819690.1.30376 WP_000819690.1.30381 WP_000819690.1.30418 WP_000819690.1.30422 WP_000819690.1.30477 WP_000819690.1.30496 WP_000819690.1.30530 WP_000819690.1.30623 WP_000819690.1.30758 WP_000819690.1.30779 WP_000819690.1.30862 WP_000819690.1.30863 WP_000819690.1.30874 WP_000819690.1.30878 WP_000819690.1.30889 WP_000819690.1.30911 WP_000819690.1.30916 WP_000819690.1.3097 WP_000819690.1.30970 WP_000819690.1.30971 WP_000819690.1.30998 WP_000819690.1.31037 WP_000819690.1.31068 WP_000819690.1.31124 WP_000819690.1.31194 WP_000819690.1.31212 WP_000819690.1.31232 WP_000819690.1.3132 WP_000819690.1.31376 WP_000819690.1.31426 WP_000819690.1.31462 WP_000819690.1.31478 WP_000819690.1.315 WP_000819690.1.31505 WP_000819690.1.31567 WP_000819690.1.31611 WP_000819690.1.31638 WP_000819690.1.31667 WP_000819690.1.31787 WP_000819690.1.31797 WP_000819690.1.31817 WP_000819690.1.31897 WP_000819690.1.31925 WP_000819690.1.31949 WP_000819690.1.31990 WP_000819690.1.31994 WP_000819690.1.32059 WP_000819690.1.32118 WP_000819690.1.32122 WP_000819690.1.32125 WP_000819690.1.32217 WP_000819690.1.32244 WP_000819690.1.32248 WP_000819690.1.32281 WP_000819690.1.32295 WP_000819690.1.32365 WP_000819690.1.32384 WP_000819690.1.32405 WP_000819690.1.3244 WP_000819690.1.32454 WP_000819690.1.32464 WP_000819690.1.32555 WP_000819690.1.32739 WP_000819690.1.32839 WP_000819690.1.32921 WP_000819690.1.32987 WP_000819690.1.3299 WP_000819690.1.3306 WP_000819690.1.33108 WP_000819690.1.33147 WP_000819690.1.33213 WP_000819690.1.33252 WP_000819690.1.33255 WP_000819690.1.33307 WP_000819690.1.3335 WP_000819690.1.33350 WP_000819690.1.33372 WP_000819690.1.3338 WP_000819690.1.33388 WP_000819690.1.33394 WP_000819690.1.33426 WP_000819690.1.3345 WP_000819690.1.33463 WP_000819690.1.33483 WP_000819690.1.33484 WP_000819690.1.33520 WP_000819690.1.33575 WP_000819690.1.33650 WP_000819690.1.33724 WP_000819690.1.33737 WP_000819690.1.33756 WP_000819690.1.33765 WP_000819690.1.33766 WP_000819690.1.33778 WP_000819690.1.33899 WP_000819690.1.33994 WP_000819690.1.34069 WP_000819690.1.34105 WP_000819690.1.34112 WP_000819690.1.34168 WP_000819690.1.3418 WP_000819690.1.34194 WP_000819690.1.34334 WP_000819690.1.34361 WP_000819690.1.3442 WP_000819690.1.34436 WP_000819690.1.34512 WP_000819690.1.34531 WP_000819690.1.34569 WP_000819690.1.34716 WP_000819690.1.34723 WP_000819690.1.3474 WP_000819690.1.34741 WP_000819690.1.34847 WP_000819690.1.34865 WP_000819690.1.34926 WP_000819690.1.34967 WP_000819690.1.35014 WP_000819690.1.35031 WP_000819690.1.35032 WP_000819690.1.35289 WP_000819690.1.35314 WP_000819690.1.35340 WP_000819690.1.35391 WP_000819690.1.35413 WP_000819690.1.3542 WP_000819690.1.35508 WP_000819690.1.35517 WP_000819690.1.35519 WP_000819690.1.35549 WP_000819690.1.35642 WP_000819690.1.35661 WP_000819690.1.35686 WP_000819690.1.35696 WP_000819690.1.35784 WP_000819690.1.3579 WP_000819690.1.35837 WP_000819690.1.35888 WP_000819690.1.35890 WP_000819690.1.35903 WP_000819690.1.36093 WP_000819690.1.36179 WP_000819690.1.36208 WP_000819690.1.36249 WP_000819690.1.36302 WP_000819690.1.36430 WP_000819690.1.36434 WP_000819690.1.36439 WP_000819690.1.36640 WP_000819690.1.36704 WP_000819690.1.36729 WP_000819690.1.36773 WP_000819690.1.36814 WP_000819690.1.36847 WP_000819690.1.36888 WP_000819690.1.36903 WP_000819690.1.36911 WP_000819690.1.36932 WP_000819690.1.3709 WP_000819690.1.37120 WP_000819690.1.37130 WP_000819690.1.37145 WP_000819690.1.37159 WP_000819690.1.37240 WP_000819690.1.37335 WP_000819690.1.37378 WP_000819690.1.37411 WP_000819690.1.37435 WP_000819690.1.37503 WP_000819690.1.37546 WP_000819690.1.37644 WP_000819690.1.37669 WP_000819690.1.37679 WP_000819690.1.3774 WP_000819690.1.37749 WP_000819690.1.37771 WP_000819690.1.37788 WP_000819690.1.37851 WP_000819690.1.37906 WP_000819690.1.37907 WP_000819690.1.37929 WP_000819690.1.38030 WP_000819690.1.38111 WP_000819690.1.38128 WP_000819690.1.38136 WP_000819690.1.38222 WP_000819690.1.38304 WP_000819690.1.38390 WP_000819690.1.38516 WP_000819690.1.38555 WP_000819690.1.38688 WP_000819690.1.3875 WP_000819690.1.38862 WP_000819690.1.38875 WP_000819690.1.38885 WP_000819690.1.38890 WP_000819690.1.38927 WP_000819690.1.38960 WP_000819690.1.39017 WP_000819690.1.39026 WP_000819690.1.39126 WP_000819690.1.39166 WP_000819690.1.39330 WP_000819690.1.39361 WP_000819690.1.39432 WP_000819690.1.39451 WP_000819690.1.39499 WP_000819690.1.39542 WP_000819690.1.39642 WP_000819690.1.39670 WP_000819690.1.39682 WP_000819690.1.39693 WP_000819690.1.39857 WP_000819690.1.39943 WP_000819690.1.39995 WP_000819690.1.40076 WP_000819690.1.4010 WP_000819690.1.40149 WP_000819690.1.40247 WP_000819690.1.40329 WP_000819690.1.40369 WP_000819690.1.40428 WP_000819690.1.40472 WP_000819690.1.40483 WP_000819690.1.40500 WP_000819690.1.40613 WP_000819690.1.40670 WP_000819690.1.40700 WP_000819690.1.40719 WP_000819690.1.40729 WP_000819690.1.40780 WP_000819690.1.40814 WP_000819690.1.40939 WP_000819690.1.40997 WP_000819690.1.41033 WP_000819690.1.41038 WP_000819690.1.4105 WP_000819690.1.41350 WP_000819690.1.41374 WP_000819690.1.41386 WP_000819690.1.41389 WP_000819690.1.41555 WP_000819690.1.41581 WP_000819690.1.41587 WP_000819690.1.41598 WP_000819690.1.41612 WP_000819690.1.41620 WP_000819690.1.41623 WP_000819690.1.41681 WP_000819690.1.4169 WP_000819690.1.41743 WP_000819690.1.41755 WP_000819690.1.41796 WP_000819690.1.4182 WP_000819690.1.41863 WP_000819690.1.41972 WP_000819690.1.42003 WP_000819690.1.4202 WP_000819690.1.42056 WP_000819690.1.42064 WP_000819690.1.42072 WP_000819690.1.42085 WP_000819690.1.42169 WP_000819690.1.42178 WP_000819690.1.42241 WP_000819690.1.4225 WP_000819690.1.42298 WP_000819690.1.42325 WP_000819690.1.42344 WP_000819690.1.42607 WP_000819690.1.42681 WP_000819690.1.42733 WP_000819690.1.42764 WP_000819690.1.42788 WP_000819690.1.42798 WP_000819690.1.42816 WP_000819690.1.42897 WP_000819690.1.42907 WP_000819690.1.42925 WP_000819690.1.42959 WP_000819690.1.42984 WP_000819690.1.42990 WP_000819690.1.43023 WP_000819690.1.43061 WP_000819690.1.43095 WP_000819690.1.43110 WP_000819690.1.43125 WP_000819690.1.43139 WP_000819690.1.43168 WP_000819690.1.43179 WP_000819690.1.43204 WP_000819690.1.43252 WP_000819690.1.43279 WP_000819690.1.43360 WP_000819690.1.43375 WP_000819690.1.43405 WP_000819690.1.43446 WP_000819690.1.43512 WP_000819690.1.43530 WP_000819690.1.43665 WP_000819690.1.43784 WP_000819690.1.4386 WP_000819690.1.43995 WP_000819690.1.44074 WP_000819690.1.44177 WP_000819690.1.44178 WP_000819690.1.44344 WP_000819690.1.44432 WP_000819690.1.44504 WP_000819690.1.44515 WP_000819690.1.44517 WP_000819690.1.44520 WP_000819690.1.44586 WP_000819690.1.44623 WP_000819690.1.44655 WP_000819690.1.44667 WP_000819690.1.447 WP_000819690.1.44714 WP_000819690.1.44715 WP_000819690.1.44780 WP_000819690.1.44856 WP_000819690.1.44868 WP_000819690.1.44876 WP_000819690.1.44892 WP_000819690.1.44899 WP_000819690.1.44940 WP_000819690.1.44993 WP_000819690.1.45042 WP_000819690.1.45080 WP_000819690.1.45091 WP_000819690.1.45094 WP_000819690.1.45140 WP_000819690.1.45157 WP_000819690.1.45162 WP_000819690.1.45223 WP_000819690.1.45242 WP_000819690.1.45267 WP_000819690.1.4527 WP_000819690.1.45281 WP_000819690.1.45419 WP_000819690.1.4545 WP_000819690.1.45450 WP_000819690.1.45456 WP_000819690.1.4546 WP_000819690.1.45542 WP_000819690.1.45555 WP_000819690.1.45574 WP_000819690.1.45610 WP_000819690.1.45645 WP_000819690.1.45705 WP_000819690.1.45763 WP_000819690.1.4577 WP_000819690.1.45773 WP_000819690.1.4582 WP_000819690.1.45859 WP_000819690.1.45862 WP_000819690.1.45874 WP_000819690.1.4597 WP_000819690.1.45972 WP_000819690.1.45977 WP_000819690.1.45979 WP_000819690.1.46035 WP_000819690.1.46037 WP_000819690.1.46050 WP_000819690.1.46062 WP_000819690.1.46078 WP_000819690.1.46171 WP_000819690.1.46172 WP_000819690.1.46185 WP_000819690.1.46195 WP_000819690.1.46248 WP_000819690.1.46333 WP_000819690.1.46339 WP_000819690.1.46353 WP_000819690.1.46389 WP_000819690.1.46529 WP_000819690.1.46619 WP_000819690.1.46648 WP_000819690.1.46720 WP_000819690.1.46736 WP_000819690.1.46770 WP_000819690.1.4680 WP_000819690.1.46906 WP_000819690.1.46914 WP_000819690.1.46929 WP_000819690.1.4694 WP_000819690.1.46947 WP_000819690.1.47002 WP_000819690.1.47065 WP_000819690.1.47107 WP_000819690.1.47111 WP_000819690.1.47175 WP_000819690.1.47193 WP_000819690.1.47282 WP_000819690.1.47334 WP_000819690.1.47408 WP_000819690.1.47450 WP_000819690.1.47493 WP_000819690.1.47522 WP_000819690.1.47541 WP_000819690.1.47617 WP_000819690.1.47629 WP_000819690.1.47669 WP_000819690.1.47680 WP_000819690.1.47747 WP_000819690.1.47835 WP_000819690.1.47851 WP_000819690.1.47908 WP_000819690.1.4792 WP_000819690.1.48046 WP_000819690.1.48064 WP_000819690.1.48067 WP_000819690.1.48116 WP_000819690.1.48142 WP_000819690.1.48156 WP_000819690.1.48187 WP_000819690.1.48223 WP_000819690.1.48272 WP_000819690.1.48282 WP_000819690.1.48310 WP_000819690.1.48338 WP_000819690.1.48376 WP_000819690.1.48398 WP_000819690.1.4840 WP_000819690.1.48427 WP_000819690.1.48437 WP_000819690.1.48479 WP_000819690.1.4852 WP_000819690.1.48580 WP_000819690.1.48664 WP_000819690.1.48670 WP_000819690.1.48723 WP_000819690.1.48769 WP_000819690.1.48782 WP_000819690.1.48869 WP_000819690.1.49018 WP_000819690.1.49071 WP_000819690.1.49094 WP_000819690.1.49105 WP_000819690.1.49171 WP_000819690.1.49189 WP_000819690.1.49196 WP_000819690.1.49199 WP_000819690.1.4924 WP_000819690.1.49257 WP_000819690.1.49301 WP_000819690.1.49326 WP_000819690.1.49362 WP_000819690.1.49418 WP_000819690.1.4945 WP_000819690.1.49518 WP_000819690.1.49549 WP_000819690.1.49581 WP_000819690.1.49582 WP_000819690.1.496 WP_000819690.1.49603 WP_000819690.1.49643 WP_000819690.1.49672 WP_000819690.1.49690 WP_000819690.1.49728 WP_000819690.1.49732 WP_000819690.1.49745 WP_000819690.1.49819 WP_000819690.1.4982 WP_000819690.1.49918 WP_000819690.1.49935 WP_000819690.1.50028 WP_000819690.1.50117 WP_000819690.1.50178 WP_000819690.1.50192 WP_000819690.1.50291 WP_000819690.1.50367 WP_000819690.1.50369 WP_000819690.1.50388 WP_000819690.1.5045 WP_000819690.1.50464 WP_000819690.1.50525 WP_000819690.1.50558 WP_000819690.1.50568 WP_000819690.1.5059 WP_000819690.1.50594 WP_000819690.1.50647 WP_000819690.1.50699 WP_000819690.1.50740 WP_000819690.1.50817 WP_000819690.1.50829 WP_000819690.1.50974 WP_000819690.1.51015 WP_000819690.1.51130 WP_000819690.1.51209 WP_000819690.1.51271 WP_000819690.1.51277 WP_000819690.1.51326 WP_000819690.1.51393 WP_000819690.1.51496 WP_000819690.1.51557 WP_000819690.1.51741 WP_000819690.1.51744 WP_000819690.1.51794 WP_000819690.1.51824 WP_000819690.1.51912 WP_000819690.1.52034 WP_000819690.1.52061 WP_000819690.1.52072 WP_000819690.1.52195 WP_000819690.1.52198 WP_000819690.1.52210 WP_000819690.1.52289 WP_000819690.1.52308 WP_000819690.1.5231 WP_000819690.1.52343 WP_000819690.1.52377 WP_000819690.1.52396 WP_000819690.1.52427 WP_000819690.1.52452 WP_000819690.1.5251 WP_000819690.1.52511 WP_000819690.1.52605 WP_000819690.1.52633 WP_000819690.1.52670 WP_000819690.1.52830 WP_000819690.1.52889 WP_000819690.1.52900 WP_000819690.1.52965 WP_000819690.1.52983 WP_000819690.1.5304 WP_000819690.1.53050 WP_000819690.1.53057 WP_000819690.1.5319 WP_000819690.1.53245 WP_000819690.1.53312 WP_000819690.1.53323 WP_000819690.1.53363 WP_000819690.1.53373 WP_000819690.1.53379 WP_000819690.1.53408 WP_000819690.1.53418 WP_000819690.1.53452 WP_000819690.1.53467 WP_000819690.1.5347 WP_000819690.1.53532 WP_000819690.1.53691 WP_000819690.1.53774 WP_000819690.1.53799 WP_000819690.1.53911 WP_000819690.1.53926 WP_000819690.1.54049 WP_000819690.1.54074 WP_000819690.1.54086 WP_000819690.1.54237 WP_000819690.1.54290 WP_000819690.1.54299 WP_000819690.1.54438 WP_000819690.1.54446 WP_000819690.1.54471 WP_000819690.1.54479 WP_000819690.1.54485 WP_000819690.1.54491 WP_000819690.1.54554 WP_000819690.1.54574 WP_000819690.1.54744 WP_000819690.1.54830 WP_000819690.1.54851 WP_000819690.1.54929 WP_000819690.1.54931 WP_000819690.1.54967 WP_000819690.1.54990 WP_000819690.1.5500 WP_000819690.1.55004 WP_000819690.1.55058 WP_000819690.1.55082 WP_000819690.1.55084 WP_000819690.1.55095 WP_000819690.1.5518 WP_000819690.1.552 WP_000819690.1.55239 WP_000819690.1.55271 WP_000819690.1.55272 WP_000819690.1.55327 WP_000819690.1.55336 WP_000819690.1.55419 WP_000819690.1.55495 WP_000819690.1.5550 WP_000819690.1.55535 WP_000819690.1.55603 WP_000819690.1.5562 WP_000819690.1.55719 WP_000819690.1.55724 WP_000819690.1.55784 WP_000819690.1.55845 WP_000819690.1.55955 WP_000819690.1.56003 WP_000819690.1.5604 WP_000819690.1.56064 WP_000819690.1.56106 WP_000819690.1.56135 WP_000819690.1.56159 WP_000819690.1.56200 WP_000819690.1.56220 WP_000819690.1.56237 WP_000819690.1.56265 WP_000819690.1.56377 WP_000819690.1.56387 WP_000819690.1.56464 WP_000819690.1.56482 WP_000819690.1.56527 WP_000819690.1.56542 WP_000819690.1.56584 WP_000819690.1.56608 WP_000819690.1.56619 WP_000819690.1.56702 WP_000819690.1.56708 WP_000819690.1.56737 WP_000819690.1.5675 WP_000819690.1.56767 WP_000819690.1.56779 WP_000819690.1.56822 WP_000819690.1.56903 WP_000819690.1.56931 WP_000819690.1.56966 WP_000819690.1.56975 WP_000819690.1.57015 WP_000819690.1.5705 WP_000819690.1.57081 WP_000819690.1.57115 WP_000819690.1.57141 WP_000819690.1.57196 WP_000819690.1.57330 WP_000819690.1.57427 WP_000819690.1.57448 WP_000819690.1.57593 WP_000819690.1.57670 WP_000819690.1.57693 WP_000819690.1.57701 WP_000819690.1.57718 WP_000819690.1.57723 WP_000819690.1.57727 WP_000819690.1.57745 WP_000819690.1.57783 WP_000819690.1.57844 WP_000819690.1.57962 WP_000819690.1.5799 WP_000819690.1.58006 WP_000819690.1.58035 WP_000819690.1.58051 WP_000819690.1.58122 WP_000819690.1.5817 WP_000819690.1.58185 WP_000819690.1.58241 WP_000819690.1.58246 WP_000819690.1.58325 WP_000819690.1.58350 WP_000819690.1.58353 WP_000819690.1.58366 WP_000819690.1.58373 WP_000819690.1.58392 WP_000819690.1.58419 WP_000819690.1.58421 WP_000819690.1.58481 WP_000819690.1.5849 WP_000819690.1.58508 WP_000819690.1.58521 WP_000819690.1.58538 WP_000819690.1.586 WP_000819690.1.58603 WP_000819690.1.58714 WP_000819690.1.58775 WP_000819690.1.58936 WP_000819690.1.58998 WP_000819690.1.5901 WP_000819690.1.5904 WP_000819690.1.59133 WP_000819690.1.5925 WP_000819690.1.59269 WP_000819690.1.59284 WP_000819690.1.59327 WP_000819690.1.59363 WP_000819690.1.59397 WP_000819690.1.59457 WP_000819690.1.59459 WP_000819690.1.59467 WP_000819690.1.59478 WP_000819690.1.59489 WP_000819690.1.59603 WP_000819690.1.59609 WP_000819690.1.59629 WP_000819690.1.59663 WP_000819690.1.59697 WP_000819690.1.59803 WP_000819690.1.59881 WP_000819690.1.59886 WP_000819690.1.59977 WP_000819690.1.60022 WP_000819690.1.60086 WP_000819690.1.60156 WP_000819690.1.60181 WP_000819690.1.60251 WP_000819690.1.60259 WP_000819690.1.60280 WP_000819690.1.60307 WP_000819690.1.60368 WP_000819690.1.60431 WP_000819690.1.60462 WP_000819690.1.60515 WP_000819690.1.60551 WP_000819690.1.60594 WP_000819690.1.60690 WP_000819690.1.60696 WP_000819690.1.60787 WP_000819690.1.60898 WP_000819690.1.60939 WP_000819690.1.60981 WP_000819690.1.61009 WP_000819690.1.61030 WP_000819690.1.61119 WP_000819690.1.61152 WP_000819690.1.61153 WP_000819690.1.6118 WP_000819690.1.61188 WP_000819690.1.61257 WP_000819690.1.61324 WP_000819690.1.61339 WP_000819690.1.61408 WP_000819690.1.61413 WP_000819690.1.61421 WP_000819690.1.61547 WP_000819690.1.61591 WP_000819690.1.6168 WP_000819690.1.61784 WP_000819690.1.61897 WP_000819690.1.61910 WP_000819690.1.61970 WP_000819690.1.62030 WP_000819690.1.62088 WP_000819690.1.62093 WP_000819690.1.62140 WP_000819690.1.62164 WP_000819690.1.62367 WP_000819690.1.62409 WP_000819690.1.62459 WP_000819690.1.62537 WP_000819690.1.62539 WP_000819690.1.62575 WP_000819690.1.62625 WP_000819690.1.62630 WP_000819690.1.62685 WP_000819690.1.62740 WP_000819690.1.62756 WP_000819690.1.62781 WP_000819690.1.62796 WP_000819690.1.62808 WP_000819690.1.62829 WP_000819690.1.62842 WP_000819690.1.62878 WP_000819690.1.62956 WP_000819690.1.63011 WP_000819690.1.63050 WP_000819690.1.631 WP_000819690.1.63132 WP_000819690.1.63182 WP_000819690.1.63195 WP_000819690.1.63233 WP_000819690.1.63244 WP_000819690.1.63273 WP_000819690.1.63279 WP_000819690.1.63296 WP_000819690.1.63307 WP_000819690.1.63319 WP_000819690.1.63322 WP_000819690.1.63324 WP_000819690.1.63335 WP_000819690.1.63337 WP_000819690.1.63383 WP_000819690.1.634 WP_000819690.1.63406 WP_000819690.1.63411 WP_000819690.1.63421 WP_000819690.1.63460 WP_000819690.1.63510 WP_000819690.1.63527 WP_000819690.1.63565 WP_000819690.1.63617 WP_000819690.1.63693 WP_000819690.1.63705 WP_000819690.1.6378 WP_000819690.1.63847 WP_000819690.1.63894 WP_000819690.1.63947 WP_000819690.1.64012 WP_000819690.1.64094 WP_000819690.1.64108 WP_000819690.1.64207 WP_000819690.1.64251 WP_000819690.1.64303 WP_000819690.1.64368 WP_000819690.1.64628 WP_000819690.1.64631 WP_000819690.1.64643 WP_000819690.1.64665 WP_000819690.1.64811 WP_000819690.1.64845 WP_000819690.1.64860 WP_000819690.1.64951 WP_000819690.1.64956 WP_000819690.1.64994 WP_000819690.1.64996 WP_000819690.1.64998 WP_000819690.1.65025 WP_000819690.1.65038 WP_000819690.1.65046 WP_000819690.1.65076 WP_000819690.1.65233 WP_000819690.1.65264 WP_000819690.1.65358 WP_000819690.1.65387 WP_000819690.1.65406 WP_000819690.1.65407 WP_000819690.1.6544 WP_000819690.1.65448 WP_000819690.1.65585 WP_000819690.1.65600 WP_000819690.1.65616 WP_000819690.1.65629 WP_000819690.1.65643 WP_000819690.1.65656 WP_000819690.1.6568 WP_000819690.1.65713 WP_000819690.1.65734 WP_000819690.1.65769 WP_000819690.1.65809 WP_000819690.1.6585 WP_000819690.1.65892 WP_000819690.1.65935 WP_000819690.1.65965 WP_000819690.1.6603 WP_000819690.1.66054 WP_000819690.1.66069 WP_000819690.1.66073 WP_000819690.1.6612 WP_000819690.1.66130 WP_000819690.1.66144 WP_000819690.1.66265 WP_000819690.1.66298 WP_000819690.1.6632 WP_000819690.1.66366 WP_000819690.1.66453 WP_000819690.1.66513 WP_000819690.1.66556 WP_000819690.1.66598 WP_000819690.1.66611 WP_000819690.1.66614 WP_000819690.1.6662 WP_000819690.1.66705 WP_000819690.1.66756 WP_000819690.1.66766 WP_000819690.1.66803 WP_000819690.1.66816 WP_000819690.1.66879 WP_000819690.1.6688 WP_000819690.1.66938 WP_000819690.1.66969 WP_000819690.1.67012 WP_000819690.1.67014 WP_000819690.1.67067 WP_000819690.1.67072 WP_000819690.1.67113 WP_000819690.1.67155 WP_000819690.1.67160 WP_000819690.1.67238 WP_000819690.1.67251 WP_000819690.1.67259 WP_000819690.1.6726 WP_000819690.1.67286 WP_000819690.1.67294 WP_000819690.1.67312 WP_000819690.1.67328 WP_000819690.1.67418 WP_000819690.1.67420 WP_000819690.1.67425 WP_000819690.1.67457 WP_000819690.1.67460 WP_000819690.1.67540 WP_000819690.1.67571 WP_000819690.1.67621 WP_000819690.1.67644 WP_000819690.1.67653 WP_000819690.1.67691 WP_000819690.1.67806 WP_000819690.1.67834 WP_000819690.1.67867 WP_000819690.1.67880 WP_000819690.1.67900 WP_000819690.1.67991 WP_000819690.1.68101 WP_000819690.1.68134 WP_000819690.1.68141 WP_000819690.1.68152 WP_000819690.1.68202 WP_000819690.1.68221 WP_000819690.1.68223 WP_000819690.1.6824 WP_000819690.1.68268 WP_000819690.1.68286 WP_000819690.1.68296 WP_000819690.1.68355 WP_000819690.1.68366 WP_000819690.1.68398 WP_000819690.1.68399 WP_000819690.1.68476 WP_000819690.1.68479 WP_000819690.1.68504 WP_000819690.1.68512 WP_000819690.1.68548 WP_000819690.1.686 WP_000819690.1.68636 WP_000819690.1.68681 WP_000819690.1.68683 WP_000819690.1.68741 WP_000819690.1.68743 WP_000819690.1.68883 WP_000819690.1.68998 WP_000819690.1.69012 WP_000819690.1.69071 WP_000819690.1.69078 WP_000819690.1.69105 WP_000819690.1.69147 WP_000819690.1.6915 WP_000819690.1.69198 WP_000819690.1.69213 WP_000819690.1.69349 WP_000819690.1.69394 WP_000819690.1.69437 WP_000819690.1.69475 WP_000819690.1.69490 WP_000819690.1.6953 WP_000819690.1.69546 WP_000819690.1.69598 WP_000819690.1.6968 WP_000819690.1.69683 WP_000819690.1.69724 WP_000819690.1.69734 WP_000819690.1.6980 WP_000819690.1.69820 WP_000819690.1.69823 WP_000819690.1.69830 WP_000819690.1.69882 WP_000819690.1.699 WP_000819690.1.69902 WP_000819690.1.69934 WP_000819690.1.69980 WP_000819690.1.69995 WP_000819690.1.70059 WP_000819690.1.70161 WP_000819690.1.70210 WP_000819690.1.70220 WP_000819690.1.70225 WP_000819690.1.70228 WP_000819690.1.70294 WP_000819690.1.703 WP_000819690.1.70311 WP_000819690.1.70313 WP_000819690.1.70334 WP_000819690.1.70448 WP_000819690.1.7046 WP_000819690.1.70487 WP_000819690.1.70495 WP_000819690.1.70527 WP_000819690.1.70554 WP_000819690.1.70558 WP_000819690.1.70564 WP_000819690.1.7064 WP_000819690.1.70664 WP_000819690.1.707 WP_000819690.1.70721 WP_000819690.1.70763 WP_000819690.1.70808 WP_000819690.1.70835 WP_000819690.1.70843 WP_000819690.1.70909 WP_000819690.1.70926 WP_000819690.1.710 WP_000819690.1.71016 WP_000819690.1.7105 WP_000819690.1.71208 WP_000819690.1.71231 WP_000819690.1.71267 WP_000819690.1.71313 WP_000819690.1.71410 WP_000819690.1.71467 WP_000819690.1.71475 WP_000819690.1.71715 WP_000819690.1.71721 WP_000819690.1.71737 WP_000819690.1.71739 WP_000819690.1.71741 WP_000819690.1.71780 WP_000819690.1.71863 WP_000819690.1.71877 WP_000819690.1.71892 WP_000819690.1.71899 WP_000819690.1.71910 WP_000819690.1.71978 WP_000819690.1.72002 WP_000819690.1.72018 WP_000819690.1.72085 WP_000819690.1.72148 WP_000819690.1.722 WP_000819690.1.72204 WP_000819690.1.72306 WP_000819690.1.72340 WP_000819690.1.72363 WP_000819690.1.72371 WP_000819690.1.72453 WP_000819690.1.72465 WP_000819690.1.72497 WP_000819690.1.7258 WP_000819690.1.7260 WP_000819690.1.72626 WP_000819690.1.72649 WP_000819690.1.72666 WP_000819690.1.72708 WP_000819690.1.72719 WP_000819690.1.72750 WP_000819690.1.72753 WP_000819690.1.72762 WP_000819690.1.72881 WP_000819690.1.72930 WP_000819690.1.72961 WP_000819690.1.72991 WP_000819690.1.73002 WP_000819690.1.73021 WP_000819690.1.73087 WP_000819690.1.73140 WP_000819690.1.73190 WP_000819690.1.73195 WP_000819690.1.73201 WP_000819690.1.73211 WP_000819690.1.73240 WP_000819690.1.73241 WP_000819690.1.73264 WP_000819690.1.73401 WP_000819690.1.73420 WP_000819690.1.73450 WP_000819690.1.73464 WP_000819690.1.73513 WP_000819690.1.73539 WP_000819690.1.7360 WP_000819690.1.73610 WP_000819690.1.7365 WP_000819690.1.73674 WP_000819690.1.73694 WP_000819690.1.73740 WP_000819690.1.73789 WP_000819690.1.73885 WP_000819690.1.73900 WP_000819690.1.73921 WP_000819690.1.73940 WP_000819690.1.73949 WP_000819690.1.73971 WP_000819690.1.74004 WP_000819690.1.7401 WP_000819690.1.7406 WP_000819690.1.74073 WP_000819690.1.74085 WP_000819690.1.74257 WP_000819690.1.74273 WP_000819690.1.74284 WP_000819690.1.74295 WP_000819690.1.74327 WP_000819690.1.74456 WP_000819690.1.74468 WP_000819690.1.74576 WP_000819690.1.74676 WP_000819690.1.74681 WP_000819690.1.74758 WP_000819690.1.74761 WP_000819690.1.74770 WP_000819690.1.74785 WP_000819690.1.74797 WP_000819690.1.7482 WP_000819690.1.74874 WP_000819690.1.74924 WP_000819690.1.75070 WP_000819690.1.75093 WP_000819690.1.75111 WP_000819690.1.75131 WP_000819690.1.75132 WP_000819690.1.75323 WP_000819690.1.75351 WP_000819690.1.75356 WP_000819690.1.75409 WP_000819690.1.75538 WP_000819690.1.75566 WP_000819690.1.75571 WP_000819690.1.75647 WP_000819690.1.75692 WP_000819690.1.75728 WP_000819690.1.75743 WP_000819690.1.75800 WP_000819690.1.75840 WP_000819690.1.75862 WP_000819690.1.75910 WP_000819690.1.76013 WP_000819690.1.7602 WP_000819690.1.76047 WP_000819690.1.76049 WP_000819690.1.76050 WP_000819690.1.76053 WP_000819690.1.76111 WP_000819690.1.76114 WP_000819690.1.76121 WP_000819690.1.76149 WP_000819690.1.76153 WP_000819690.1.76179 WP_000819690.1.7627 WP_000819690.1.76282 WP_000819690.1.76313 WP_000819690.1.76424 WP_000819690.1.76426 WP_000819690.1.76431 WP_000819690.1.76463 WP_000819690.1.76497 WP_000819690.1.765 WP_000819690.1.76674 WP_000819690.1.76711 WP_000819690.1.76718 WP_000819690.1.76798 WP_000819690.1.76803 WP_000819690.1.76829 WP_000819690.1.7694 WP_000819690.1.77043 WP_000819690.1.77137 WP_000819690.1.77158 WP_000819690.1.77187 WP_000819690.1.77190 WP_000819690.1.77203 WP_000819690.1.77297 WP_000819690.1.77298 WP_000819690.1.77331 WP_000819690.1.77346 WP_000819690.1.77359 WP_000819690.1.77388 WP_000819690.1.77426 WP_000819690.1.77498 WP_000819690.1.7752 WP_000819690.1.77532 WP_000819690.1.77650 WP_000819690.1.77735 WP_000819690.1.77791 WP_000819690.1.7785 WP_000819690.1.7786 WP_000819690.1.77893 WP_000819690.1.77915 WP_000819690.1.77922 WP_000819690.1.77930 WP_000819690.1.77952 WP_000819690.1.77986 WP_000819690.1.78038 WP_000819690.1.78082 WP_000819690.1.78093 WP_000819690.1.78095 WP_000819690.1.7810 WP_000819690.1.78164 WP_000819690.1.78179 WP_000819690.1.78194 WP_000819690.1.78208 WP_000819690.1.78304 WP_000819690.1.78330 WP_000819690.1.78335 WP_000819690.1.78371 WP_000819690.1.78434 WP_000819690.1.78436 WP_000819690.1.78470 WP_000819690.1.78489 WP_000819690.1.78494 WP_000819690.1.7853 WP_000819690.1.78573 WP_000819690.1.78585 WP_000819690.1.78592 WP_000819690.1.78662 WP_000819690.1.78685 WP_000819690.1.78736 WP_000819690.1.78758 WP_000819690.1.78763 WP_000819690.1.78816 WP_000819690.1.78920 WP_000819690.1.78937 WP_000819690.1.78991 WP_000819690.1.78995 WP_000819690.1.7905 WP_000819690.1.79110 WP_000819690.1.7914 WP_000819690.1.79143 WP_000819690.1.79178 WP_000819690.1.79192 WP_000819690.1.79270 WP_000819690.1.79275 WP_000819690.1.79285 WP_000819690.1.79378 WP_000819690.1.79408 WP_000819690.1.79552 WP_000819690.1.79581 WP_000819690.1.79627 WP_000819690.1.79676 WP_000819690.1.79677 WP_000819690.1.79731 WP_000819690.1.79763 WP_000819690.1.79815 WP_000819690.1.79904 WP_000819690.1.79949 WP_000819690.1.80009 WP_000819690.1.80013 WP_000819690.1.80029 WP_000819690.1.80086 WP_000819690.1.80119 WP_000819690.1.80120 WP_000819690.1.80122 WP_000819690.1.80146 WP_000819690.1.80178 WP_000819690.1.80184 WP_000819690.1.80210 WP_000819690.1.80244 WP_000819690.1.80274 WP_000819690.1.80316 WP_000819690.1.80361 WP_000819690.1.80389 WP_000819690.1.8040 WP_000819690.1.80434 WP_000819690.1.80521 WP_000819690.1.80582 WP_000819690.1.80653 WP_000819690.1.80745 WP_000819690.1.80855 WP_000819690.1.80899 WP_000819690.1.81010 WP_000819690.1.81022 WP_000819690.1.81049 WP_000819690.1.81052 WP_000819690.1.81064 WP_000819690.1.81095 WP_000819690.1.81172 WP_000819690.1.81184 WP_000819690.1.81214 WP_000819690.1.81228 WP_000819690.1.81232 WP_000819690.1.81288 WP_000819690.1.81290 WP_000819690.1.81344 WP_000819690.1.81379 WP_000819690.1.81384 WP_000819690.1.81508 WP_000819690.1.81574 WP_000819690.1.8160 WP_000819690.1.81604 WP_000819690.1.81619 WP_000819690.1.81645 WP_000819690.1.8180 WP_000819690.1.81837 WP_000819690.1.81838 WP_000819690.1.8185 WP_000819690.1.81969 WP_000819690.1.81990 WP_000819690.1.8206 WP_000819690.1.82103 WP_000819690.1.82174 WP_000819690.1.82184 WP_000819690.1.82253 WP_000819690.1.82278 WP_000819690.1.82301 WP_000819690.1.82349 WP_000819690.1.82406 WP_000819690.1.82458 WP_000819690.1.82468 WP_000819690.1.82525 WP_000819690.1.82535 WP_000819690.1.82558 WP_000819690.1.8266 WP_000819690.1.82678 WP_000819690.1.82768 WP_000819690.1.82824 WP_000819690.1.82855 WP_000819690.1.82930 WP_000819690.1.82941 WP_000819690.1.83046 WP_000819690.1.83054 WP_000819690.1.83078 WP_000819690.1.83086 WP_000819690.1.83103 WP_000819690.1.8318 WP_000819690.1.83203 WP_000819690.1.83291 WP_000819690.1.83359 WP_000819690.1.83405 WP_000819690.1.83417 WP_000819690.1.8346 WP_000819690.1.83467 WP_000819690.1.83472 WP_000819690.1.83479 WP_000819690.1.83520 WP_000819690.1.83553 WP_000819690.1.8366 WP_000819690.1.83674 WP_000819690.1.83728 WP_000819690.1.83750 WP_000819690.1.83756 WP_000819690.1.83758 WP_000819690.1.83788 WP_000819690.1.83797 WP_000819690.1.83844 WP_000819690.1.8385 WP_000819690.1.83886 WP_000819690.1.83989 WP_000819690.1.84025 WP_000819690.1.84054 WP_000819690.1.84118 WP_000819690.1.84129 WP_000819690.1.84161 WP_000819690.1.84188 WP_000819690.1.84275 WP_000819690.1.84415 WP_000819690.1.84418 WP_000819690.1.84508 WP_000819690.1.84590 WP_000819690.1.84596 WP_000819690.1.84608 WP_000819690.1.8462 WP_000819690.1.84648 WP_000819690.1.84651 WP_000819690.1.84696 WP_000819690.1.84826 WP_000819690.1.84847 WP_000819690.1.84854 WP_000819690.1.84924 WP_000819690.1.8496 WP_000819690.1.84975 WP_000819690.1.84978 WP_000819690.1.85017 WP_000819690.1.85026 WP_000819690.1.85045 WP_000819690.1.85070 WP_000819690.1.85118 WP_000819690.1.85160 WP_000819690.1.85229 WP_000819690.1.85289 WP_000819690.1.85292 WP_000819690.1.85302 WP_000819690.1.85375 WP_000819690.1.85376 WP_000819690.1.85409 WP_000819690.1.85441 WP_000819690.1.85485 WP_000819690.1.8551 WP_000819690.1.85585 WP_000819690.1.85611 WP_000819690.1.85730 WP_000819690.1.85732 WP_000819690.1.85858 WP_000819690.1.85906 WP_000819690.1.85924 WP_000819690.1.85971 WP_000819690.1.85980 WP_000819690.1.85989 WP_000819690.1.86036 WP_000819690.1.86042 WP_000819690.1.86086 WP_000819690.1.862 WP_000819690.1.86209 WP_000819690.1.86248 WP_000819690.1.86281 WP_000819690.1.86315 WP_000819690.1.8636 WP_000819690.1.86363 WP_000819690.1.86390 WP_000819690.1.86473 WP_000819690.1.86531 WP_000819690.1.86606 WP_000819690.1.86664 WP_000819690.1.86704 WP_000819690.1.86736 WP_000819690.1.86745 WP_000819690.1.86779 WP_000819690.1.86793 WP_000819690.1.86795 WP_000819690.1.8690 WP_000819690.1.86968 WP_000819690.1.86999 WP_000819690.1.87088 WP_000819690.1.87097 WP_000819690.1.87100 WP_000819690.1.87133 WP_000819690.1.87137 WP_000819690.1.87168 WP_000819690.1.87190 WP_000819690.1.87204 WP_000819690.1.87221 WP_000819690.1.87272 WP_000819690.1.87296 WP_000819690.1.87363 WP_000819690.1.87372 WP_000819690.1.87388 WP_000819690.1.87486 WP_000819690.1.87511 WP_000819690.1.87595 WP_000819690.1.8764 WP_000819690.1.87734 WP_000819690.1.87745 WP_000819690.1.87838 WP_000819690.1.87841 WP_000819690.1.87854 WP_000819690.1.87865 WP_000819690.1.8791 WP_000819690.1.87937 WP_000819690.1.87964 WP_000819690.1.87967 WP_000819690.1.88169 WP_000819690.1.88309 WP_000819690.1.88373 WP_000819690.1.88375 WP_000819690.1.88418 WP_000819690.1.88430 WP_000819690.1.88440 WP_000819690.1.88449 WP_000819690.1.88555 WP_000819690.1.88563 WP_000819690.1.88585 WP_000819690.1.8859 WP_000819690.1.88600 WP_000819690.1.88614 WP_000819690.1.88696 WP_000819690.1.88753 WP_000819690.1.88761 WP_000819690.1.88771 WP_000819690.1.88781 WP_000819690.1.88843 WP_000819690.1.8886 WP_000819690.1.88878 WP_000819690.1.88897 WP_000819690.1.88954 WP_000819690.1.88960 WP_000819690.1.88962 WP_000819690.1.89012 WP_000819690.1.89024 WP_000819690.1.89125 WP_000819690.1.89164 WP_000819690.1.8918 WP_000819690.1.89184 WP_000819690.1.89262 WP_000819690.1.89290 WP_000819690.1.89348 WP_000819690.1.89350 WP_000819690.1.89390 WP_000819690.1.89404 WP_000819690.1.89433 WP_000819690.1.897 WP_000819690.1.89779 WP_000819690.1.89794 WP_000819690.1.898 WP_000819690.1.89863 WP_000819690.1.89908 WP_000819690.1.89949 WP_000819690.1.89950 WP_000819690.1.90069 WP_000819690.1.90173 WP_000819690.1.90174 WP_000819690.1.90217 WP_000819690.1.90246 WP_000819690.1.90250 WP_000819690.1.90386 WP_000819690.1.90447 WP_000819690.1.90454 WP_000819690.1.90488 WP_000819690.1.90506 WP_000819690.1.90533 WP_000819690.1.9055 WP_000819690.1.90556 WP_000819690.1.90661 WP_000819690.1.90698 WP_000819690.1.9071 WP_000819690.1.9076 WP_000819690.1.90923 WP_000819690.1.91005 WP_000819690.1.91019 WP_000819690.1.91150 WP_000819690.1.9122 WP_000819690.1.91280 WP_000819690.1.91287 WP_000819690.1.91371 WP_000819690.1.91447 WP_000819690.1.91486 WP_000819690.1.91525 WP_000819690.1.91530 WP_000819690.1.9155 WP_000819690.1.91586 WP_000819690.1.91611 WP_000819690.1.91634 WP_000819690.1.91670 WP_000819690.1.917 WP_000819690.1.91704 WP_000819690.1.91745 WP_000819690.1.91848 WP_000819690.1.91918 WP_000819690.1.91969 WP_000819690.1.92125 WP_000819690.1.92186 WP_000819690.1.92212 WP_000819690.1.92228 WP_000819690.1.92244 WP_000819690.1.92249 WP_000819690.1.92254 WP_000819690.1.923 WP_000819690.1.92303 WP_000819690.1.92391 WP_000819690.1.92405 WP_000819690.1.92415 WP_000819690.1.92425 WP_000819690.1.9247 WP_000819690.1.92512 WP_000819690.1.92667 WP_000819690.1.92674 WP_000819690.1.92718 WP_000819690.1.92765 WP_000819690.1.92795 WP_000819690.1.9286 WP_000819690.1.92918 WP_000819690.1.9296 WP_000819690.1.92960 WP_000819690.1.92965 WP_000819690.1.92997 WP_000819690.1.93047 WP_000819690.1.93071 WP_000819690.1.93147 WP_000819690.1.93197 WP_000819690.1.93243 WP_000819690.1.93254 WP_000819690.1.93260 WP_000819690.1.93296 WP_000819690.1.93378 WP_000819690.1.93471 WP_000819690.1.93567 WP_000819690.1.93579 WP_000819690.1.93708 WP_000819690.1.93736 WP_000819690.1.93758 WP_000819690.1.93762 WP_000819690.1.93775 WP_000819690.1.93890 WP_000819690.1.94 WP_000819690.1.94053 WP_000819690.1.94080 WP_000819690.1.9411 WP_000819690.1.94122 WP_000819690.1.94123 WP_000819690.1.94130 WP_000819690.1.94242 WP_000819690.1.94245 WP_000819690.1.94248 WP_000819690.1.94268 WP_000819690.1.94287 WP_000819690.1.9430 WP_000819690.1.94320 WP_000819690.1.94324 WP_000819690.1.94337 WP_000819690.1.94341 WP_000819690.1.94484 WP_000819690.1.94505 WP_000819690.1.94536 WP_000819690.1.9455 WP_000819690.1.94825 WP_000819690.1.94969 WP_000819690.1.95008 WP_000819690.1.95023 WP_000819690.1.95029 WP_000819690.1.95033 WP_000819690.1.95075 WP_000819690.1.95156 WP_000819690.1.95193 WP_000819690.1.95263 WP_000819690.1.95281 WP_000819690.1.95294 WP_000819690.1.95318 WP_000819690.1.95386 WP_000819690.1.95415 WP_000819690.1.95494 WP_000819690.1.95512 WP_000819690.1.95519 WP_000819690.1.95522 WP_000819690.1.95550 WP_000819690.1.95560 WP_000819690.1.9563 WP_000819690.1.95683 WP_000819690.1.95780 WP_000819690.1.95804 WP_000819690.1.95832 WP_000819690.1.959 WP_000819690.1.95962 WP_000819690.1.96160 WP_000819690.1.96163 WP_000819690.1.96209 WP_000819690.1.96218 WP_000819690.1.96305 WP_000819690.1.96316 WP_000819690.1.96468 WP_000819690.1.96568 WP_000819690.1.96634 WP_000819690.1.96646 WP_000819690.1.96688 WP_000819690.1.96727 WP_000819690.1.96770 WP_000819690.1.96804 WP_000819690.1.96895 WP_000819690.1.96918 WP_000819690.1.9695 WP_000819690.1.96976 WP_000819690.1.97001 WP_000819690.1.97007 WP_000819690.1.97072 WP_000819690.1.97117 WP_000819690.1.97138 WP_000819690.1.97191 WP_000819690.1.97267 WP_000819690.1.97295 WP_000819690.1.97411 WP_000819690.1.9743 WP_000819690.1.97536 WP_000819690.1.97574 WP_000819690.1.97627 WP_000819690.1.97729 WP_000819690.1.97731 WP_000819690.1.97739 WP_000819690.1.97758 WP_000819690.1.97786 WP_000819690.1.97827 WP_000819690.1.97835 WP_000819690.1.9789 WP_000819690.1.97899 WP_000819690.1.97928 WP_000819690.1.97967 WP_000819690.1.97999 WP_000819690.1.98011 WP_000819690.1.98033 WP_000819690.1.98051 WP_000819690.1.98242 WP_000819690.1.98360 WP_000819690.1.98361 WP_000819690.1.98379 WP_000819690.1.98411 WP_000819690.1.98456 WP_000819690.1.98497 WP_000819690.1.98512 WP_000819690.1.98552 WP_000819690.1.986 WP_000819690.1.98655 WP_000819690.1.98706 WP_000819690.1.98767 WP_000819690.1.98837 WP_000819690.1.98858 WP_000819690.1.98874 WP_000819690.1.98967 WP_000819690.1.99009 WP_000819690.1.99025 WP_000819690.1.9912 WP_000819690.1.99155 WP_000819690.1.99171 WP_000819690.1.99217 WP_000819690.1.99249 WP_000819690.1.99359 WP_000819690.1.9936 WP_000819690.1.99405 WP_000819690.1.99430 WP_000819690.1.99459 WP_000819690.1.99492 WP_000819690.1.99494 WP_000819690.1.99519 WP_000819690.1.99536 WP_000819690.1.99538 WP_000819690.1.99564 WP_000819690.1.99569 WP_000819690.1.9960 WP_000819690.1.99631 WP_000819690.1.99638 WP_000819690.1.99686 WP_000819690.1.99759 WP_000819690.1.99802 WP_000819690.1.99850 WP_000819690.1.99860 WP_000819690.1.9987 WP_000819690.1.99888 WP_000819690.1.99926 WP_000819690.1.99956 WP_000819690.1.99979 WP_000819690.1.99985 YP_499598.1.76163 196620.MW0985 282459.SAS1037 426430.NWMN_0968 451515.SAUSA300_1002 451516.USA300HOU_1043 93061.SAOUHSC_01049 93062.SACOL1111 gi|161509283|ref|YP_001574942.1| gi|379014295|ref|YP_005290531.1| gi|49485940|ref|YP_043161.1| gi|554643835|ref|YP_008715626.1| gi|479329014|ref|YP_007868073.1| gi|57651711|ref|YP_185975.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]