SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|521213037|ref|YP_008169383.1| from Staphylococcus aureus Bmb9393

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521213037|ref|YP_008169383.1|
Domain Number 1 Region: 40-258
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.84e-56
Family Phosphate binding protein-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|521213037|ref|YP_008169383.1|
Sequence length 260
Comment molybdate transport system substrate-binding protein [Staphylococcus aureus Bmb9393]
Sequence
MKLKRLFAVVIAMLLVLAGCSNSNDNNESKKDDADNGKKQEIQVAAAASLTDVTKKLASE
FKKEHKNADIKFNYGGSGALRKQIESGAPVDVFMSANTKDVDALKDKNKAHDTYKYAKNS
LVLIGDKDSNYTSVKDLKDNDKLALGEVKTVPAGKYAKQYLDNNNLFKEVESKIVYAKDV
KQVLNYVEKGNAKQGFVYKTDLYKQNKKIDTVKVIKEVELKKPITYEAGATSDSKLAKEW
MEFLKSDKAKEILKEYHFAA
Download sequence
Identical sequences A0A0D6H3T6 A0A0E1AN54 A0A0H2WZ94 A0A0H2XGY9 A0A0H3K9Z9 A0A1E8WU30 A0A2K4E6Q9 Q2FVX4
gi|88196194|ref|YP_501011.1| gi|151222391|ref|YP_001333213.1| gi|384870828|ref|YP_005753542.1| gi|161510474|ref|YP_001576133.1| gi|57652212|ref|YP_187079.1| 426430.NWMN_2179 451515.SAUSA300_2230 451516.USA300HOU_2261 93061.SAOUHSC_02549 93062.SACOL2272 gi|384862923|ref|YP_005745643.1| WP_000769517.1.100013 WP_000769517.1.100041 WP_000769517.1.100049 WP_000769517.1.100057 WP_000769517.1.100067 WP_000769517.1.100072 WP_000769517.1.100088 WP_000769517.1.100090 WP_000769517.1.100094 WP_000769517.1.100154 WP_000769517.1.100180 WP_000769517.1.100189 WP_000769517.1.100298 WP_000769517.1.100307 WP_000769517.1.100352 WP_000769517.1.100391 WP_000769517.1.10041 WP_000769517.1.100618 WP_000769517.1.100631 WP_000769517.1.100647 WP_000769517.1.100761 WP_000769517.1.100768 WP_000769517.1.100834 WP_000769517.1.100903 WP_000769517.1.100920 WP_000769517.1.100963 WP_000769517.1.100981 WP_000769517.1.100987 WP_000769517.1.101017 WP_000769517.1.101084 WP_000769517.1.101177 WP_000769517.1.101240 WP_000769517.1.101266 WP_000769517.1.101327 WP_000769517.1.101375 WP_000769517.1.101393 WP_000769517.1.101490 WP_000769517.1.101505 WP_000769517.1.101566 WP_000769517.1.101570 WP_000769517.1.101615 WP_000769517.1.101617 WP_000769517.1.10166 WP_000769517.1.101757 WP_000769517.1.101788 WP_000769517.1.101950 WP_000769517.1.102070 WP_000769517.1.1022 WP_000769517.1.10232 WP_000769517.1.10397 WP_000769517.1.10431 WP_000769517.1.10486 WP_000769517.1.10503 WP_000769517.1.10542 WP_000769517.1.10543 WP_000769517.1.10565 WP_000769517.1.10614 WP_000769517.1.10679 WP_000769517.1.10707 WP_000769517.1.10726 WP_000769517.1.10742 WP_000769517.1.10950 WP_000769517.1.11129 WP_000769517.1.1120 WP_000769517.1.11287 WP_000769517.1.11294 WP_000769517.1.11348 WP_000769517.1.11353 WP_000769517.1.1136 WP_000769517.1.11377 WP_000769517.1.11407 WP_000769517.1.11488 WP_000769517.1.11492 WP_000769517.1.11525 WP_000769517.1.11558 WP_000769517.1.11592 WP_000769517.1.11665 WP_000769517.1.11692 WP_000769517.1.117 WP_000769517.1.11719 WP_000769517.1.11720 WP_000769517.1.11795 WP_000769517.1.11829 WP_000769517.1.11991 WP_000769517.1.12005 WP_000769517.1.1205 WP_000769517.1.12073 WP_000769517.1.12098 WP_000769517.1.12123 WP_000769517.1.12179 WP_000769517.1.12181 WP_000769517.1.12233 WP_000769517.1.12297 WP_000769517.1.12328 WP_000769517.1.12447 WP_000769517.1.12498 WP_000769517.1.12639 WP_000769517.1.12715 WP_000769517.1.12771 WP_000769517.1.12822 WP_000769517.1.12833 WP_000769517.1.12845 WP_000769517.1.12862 WP_000769517.1.12903 WP_000769517.1.12937 WP_000769517.1.13039 WP_000769517.1.13072 WP_000769517.1.13091 WP_000769517.1.13104 WP_000769517.1.13322 WP_000769517.1.13468 WP_000769517.1.1347 WP_000769517.1.13486 WP_000769517.1.13531 WP_000769517.1.1355 WP_000769517.1.13556 WP_000769517.1.13568 WP_000769517.1.13617 WP_000769517.1.13654 WP_000769517.1.13683 WP_000769517.1.13727 WP_000769517.1.1374 WP_000769517.1.13755 WP_000769517.1.13757 WP_000769517.1.13804 WP_000769517.1.13805 WP_000769517.1.13914 WP_000769517.1.13940 WP_000769517.1.13983 WP_000769517.1.14071 WP_000769517.1.14112 WP_000769517.1.14153 WP_000769517.1.14233 WP_000769517.1.1426 WP_000769517.1.14364 WP_000769517.1.14365 WP_000769517.1.14366 WP_000769517.1.14394 WP_000769517.1.14418 WP_000769517.1.14475 WP_000769517.1.147 WP_000769517.1.14744 WP_000769517.1.1477 WP_000769517.1.14790 WP_000769517.1.14809 WP_000769517.1.14869 WP_000769517.1.14888 WP_000769517.1.14902 WP_000769517.1.14987 WP_000769517.1.15000 WP_000769517.1.15091 WP_000769517.1.15228 WP_000769517.1.15255 WP_000769517.1.15263 WP_000769517.1.15278 WP_000769517.1.15329 WP_000769517.1.15389 WP_000769517.1.15399 WP_000769517.1.15409 WP_000769517.1.15438 WP_000769517.1.1545 WP_000769517.1.15489 WP_000769517.1.15505 WP_000769517.1.15524 WP_000769517.1.15572 WP_000769517.1.15687 WP_000769517.1.15706 WP_000769517.1.1579 WP_000769517.1.15818 WP_000769517.1.1583 WP_000769517.1.15838 WP_000769517.1.15883 WP_000769517.1.15892 WP_000769517.1.15897 WP_000769517.1.15898 WP_000769517.1.15928 WP_000769517.1.15957 WP_000769517.1.15972 WP_000769517.1.1600 WP_000769517.1.1606 WP_000769517.1.16112 WP_000769517.1.16213 WP_000769517.1.16237 WP_000769517.1.16362 WP_000769517.1.16417 WP_000769517.1.16554 WP_000769517.1.16569 WP_000769517.1.16603 WP_000769517.1.16617 WP_000769517.1.16628 WP_000769517.1.16672 WP_000769517.1.16679 WP_000769517.1.16688 WP_000769517.1.16703 WP_000769517.1.16757 WP_000769517.1.16768 WP_000769517.1.16770 WP_000769517.1.16776 WP_000769517.1.16892 WP_000769517.1.16946 WP_000769517.1.17038 WP_000769517.1.17104 WP_000769517.1.17137 WP_000769517.1.17169 WP_000769517.1.17210 WP_000769517.1.17231 WP_000769517.1.17234 WP_000769517.1.17249 WP_000769517.1.17256 WP_000769517.1.17320 WP_000769517.1.1740 WP_000769517.1.17450 WP_000769517.1.17485 WP_000769517.1.17520 WP_000769517.1.17581 WP_000769517.1.17650 WP_000769517.1.17657 WP_000769517.1.17666 WP_000769517.1.17676 WP_000769517.1.17770 WP_000769517.1.17834 WP_000769517.1.17845 WP_000769517.1.17859 WP_000769517.1.17876 WP_000769517.1.17929 WP_000769517.1.17951 WP_000769517.1.18016 WP_000769517.1.18035 WP_000769517.1.18074 WP_000769517.1.18105 WP_000769517.1.18197 WP_000769517.1.18290 WP_000769517.1.18320 WP_000769517.1.1835 WP_000769517.1.18437 WP_000769517.1.18451 WP_000769517.1.1851 WP_000769517.1.18516 WP_000769517.1.18527 WP_000769517.1.18529 WP_000769517.1.18562 WP_000769517.1.18611 WP_000769517.1.18668 WP_000769517.1.18758 WP_000769517.1.18809 WP_000769517.1.18830 WP_000769517.1.18836 WP_000769517.1.18879 WP_000769517.1.18918 WP_000769517.1.18938 WP_000769517.1.18987 WP_000769517.1.19009 WP_000769517.1.1901 WP_000769517.1.19027 WP_000769517.1.19149 WP_000769517.1.19179 WP_000769517.1.192 WP_000769517.1.19272 WP_000769517.1.19390 WP_000769517.1.19411 WP_000769517.1.19444 WP_000769517.1.19509 WP_000769517.1.19575 WP_000769517.1.19733 WP_000769517.1.1975 WP_000769517.1.19765 WP_000769517.1.19775 WP_000769517.1.19807 WP_000769517.1.19853 WP_000769517.1.20057 WP_000769517.1.20101 WP_000769517.1.2013 WP_000769517.1.20155 WP_000769517.1.20160 WP_000769517.1.20210 WP_000769517.1.20235 WP_000769517.1.20354 WP_000769517.1.20386 WP_000769517.1.20473 WP_000769517.1.20554 WP_000769517.1.20772 WP_000769517.1.20833 WP_000769517.1.20838 WP_000769517.1.20860 WP_000769517.1.20975 WP_000769517.1.21013 WP_000769517.1.21054 WP_000769517.1.21080 WP_000769517.1.2128 WP_000769517.1.21312 WP_000769517.1.21356 WP_000769517.1.21386 WP_000769517.1.21402 WP_000769517.1.21465 WP_000769517.1.2154 WP_000769517.1.21583 WP_000769517.1.21601 WP_000769517.1.21679 WP_000769517.1.21712 WP_000769517.1.21820 WP_000769517.1.21890 WP_000769517.1.21901 WP_000769517.1.22045 WP_000769517.1.22065 WP_000769517.1.22163 WP_000769517.1.22165 WP_000769517.1.22170 WP_000769517.1.22174 WP_000769517.1.22246 WP_000769517.1.22344 WP_000769517.1.22367 WP_000769517.1.22526 WP_000769517.1.22551 WP_000769517.1.22657 WP_000769517.1.22730 WP_000769517.1.22731 WP_000769517.1.2280 WP_000769517.1.22811 WP_000769517.1.22843 WP_000769517.1.22859 WP_000769517.1.22994 WP_000769517.1.23004 WP_000769517.1.23152 WP_000769517.1.23228 WP_000769517.1.23238 WP_000769517.1.23381 WP_000769517.1.23420 WP_000769517.1.23450 WP_000769517.1.23489 WP_000769517.1.23491 WP_000769517.1.23541 WP_000769517.1.23544 WP_000769517.1.23586 WP_000769517.1.23613 WP_000769517.1.2365 WP_000769517.1.23822 WP_000769517.1.23849 WP_000769517.1.23907 WP_000769517.1.23935 WP_000769517.1.23998 WP_000769517.1.24167 WP_000769517.1.2423 WP_000769517.1.24241 WP_000769517.1.24279 WP_000769517.1.24364 WP_000769517.1.24418 WP_000769517.1.2442 WP_000769517.1.24443 WP_000769517.1.24519 WP_000769517.1.2458 WP_000769517.1.24617 WP_000769517.1.24745 WP_000769517.1.24781 WP_000769517.1.2480 WP_000769517.1.24802 WP_000769517.1.24891 WP_000769517.1.25083 WP_000769517.1.25170 WP_000769517.1.25331 WP_000769517.1.25438 WP_000769517.1.25469 WP_000769517.1.25479 WP_000769517.1.25567 WP_000769517.1.25593 WP_000769517.1.25634 WP_000769517.1.25737 WP_000769517.1.25770 WP_000769517.1.2579 WP_000769517.1.25820 WP_000769517.1.25867 WP_000769517.1.25868 WP_000769517.1.25881 WP_000769517.1.25891 WP_000769517.1.25924 WP_000769517.1.2593 WP_000769517.1.26006 WP_000769517.1.26015 WP_000769517.1.262 WP_000769517.1.26293 WP_000769517.1.26307 WP_000769517.1.26370 WP_000769517.1.26405 WP_000769517.1.26481 WP_000769517.1.2656 WP_000769517.1.2661 WP_000769517.1.26626 WP_000769517.1.2664 WP_000769517.1.26663 WP_000769517.1.26733 WP_000769517.1.26771 WP_000769517.1.26790 WP_000769517.1.26927 WP_000769517.1.26958 WP_000769517.1.27042 WP_000769517.1.27154 WP_000769517.1.27246 WP_000769517.1.27311 WP_000769517.1.27333 WP_000769517.1.2734 WP_000769517.1.27345 WP_000769517.1.27455 WP_000769517.1.27457 WP_000769517.1.27551 WP_000769517.1.27562 WP_000769517.1.2759 WP_000769517.1.27608 WP_000769517.1.27614 WP_000769517.1.27615 WP_000769517.1.27621 WP_000769517.1.27654 WP_000769517.1.27670 WP_000769517.1.2768 WP_000769517.1.27717 WP_000769517.1.27748 WP_000769517.1.27817 WP_000769517.1.27854 WP_000769517.1.27950 WP_000769517.1.27953 WP_000769517.1.27972 WP_000769517.1.28007 WP_000769517.1.28025 WP_000769517.1.28063 WP_000769517.1.28071 WP_000769517.1.28088 WP_000769517.1.28117 WP_000769517.1.28138 WP_000769517.1.28147 WP_000769517.1.28158 WP_000769517.1.28191 WP_000769517.1.28207 WP_000769517.1.28358 WP_000769517.1.28360 WP_000769517.1.28376 WP_000769517.1.28381 WP_000769517.1.28498 WP_000769517.1.28502 WP_000769517.1.28527 WP_000769517.1.28532 WP_000769517.1.28629 WP_000769517.1.28650 WP_000769517.1.28710 WP_000769517.1.28725 WP_000769517.1.28862 WP_000769517.1.28887 WP_000769517.1.28933 WP_000769517.1.28960 WP_000769517.1.28970 WP_000769517.1.29014 WP_000769517.1.29090 WP_000769517.1.29107 WP_000769517.1.29188 WP_000769517.1.29207 WP_000769517.1.29272 WP_000769517.1.29282 WP_000769517.1.29285 WP_000769517.1.29312 WP_000769517.1.29372 WP_000769517.1.29373 WP_000769517.1.29381 WP_000769517.1.29511 WP_000769517.1.29541 WP_000769517.1.29561 WP_000769517.1.29596 WP_000769517.1.29644 WP_000769517.1.29676 WP_000769517.1.2975 WP_000769517.1.29758 WP_000769517.1.29781 WP_000769517.1.29805 WP_000769517.1.29885 WP_000769517.1.29956 WP_000769517.1.29963 WP_000769517.1.30012 WP_000769517.1.30023 WP_000769517.1.30033 WP_000769517.1.30047 WP_000769517.1.30057 WP_000769517.1.30154 WP_000769517.1.30176 WP_000769517.1.30274 WP_000769517.1.30333 WP_000769517.1.30350 WP_000769517.1.30367 WP_000769517.1.30376 WP_000769517.1.30381 WP_000769517.1.30418 WP_000769517.1.30422 WP_000769517.1.30458 WP_000769517.1.30477 WP_000769517.1.30530 WP_000769517.1.30623 WP_000769517.1.30758 WP_000769517.1.30779 WP_000769517.1.30862 WP_000769517.1.30863 WP_000769517.1.30874 WP_000769517.1.30878 WP_000769517.1.30889 WP_000769517.1.30916 WP_000769517.1.3097 WP_000769517.1.30971 WP_000769517.1.30998 WP_000769517.1.31037 WP_000769517.1.31068 WP_000769517.1.31124 WP_000769517.1.31194 WP_000769517.1.31232 WP_000769517.1.31376 WP_000769517.1.31462 WP_000769517.1.31478 WP_000769517.1.315 WP_000769517.1.31567 WP_000769517.1.31611 WP_000769517.1.31638 WP_000769517.1.31667 WP_000769517.1.31787 WP_000769517.1.31791 WP_000769517.1.31797 WP_000769517.1.31817 WP_000769517.1.31897 WP_000769517.1.31925 WP_000769517.1.31949 WP_000769517.1.31990 WP_000769517.1.31994 WP_000769517.1.32059 WP_000769517.1.32118 WP_000769517.1.32122 WP_000769517.1.32125 WP_000769517.1.32167 WP_000769517.1.32217 WP_000769517.1.32244 WP_000769517.1.32248 WP_000769517.1.32281 WP_000769517.1.32295 WP_000769517.1.32365 WP_000769517.1.32384 WP_000769517.1.32405 WP_000769517.1.3244 WP_000769517.1.32454 WP_000769517.1.32464 WP_000769517.1.32739 WP_000769517.1.32839 WP_000769517.1.32921 WP_000769517.1.32965 WP_000769517.1.32987 WP_000769517.1.3299 WP_000769517.1.3306 WP_000769517.1.33108 WP_000769517.1.33147 WP_000769517.1.33213 WP_000769517.1.33252 WP_000769517.1.33255 WP_000769517.1.33307 WP_000769517.1.3335 WP_000769517.1.33350 WP_000769517.1.33372 WP_000769517.1.3338 WP_000769517.1.33388 WP_000769517.1.33394 WP_000769517.1.33426 WP_000769517.1.3345 WP_000769517.1.33463 WP_000769517.1.33483 WP_000769517.1.33484 WP_000769517.1.33520 WP_000769517.1.33575 WP_000769517.1.33650 WP_000769517.1.33724 WP_000769517.1.33737 WP_000769517.1.33766 WP_000769517.1.33778 WP_000769517.1.33899 WP_000769517.1.33949 WP_000769517.1.33994 WP_000769517.1.34069 WP_000769517.1.34105 WP_000769517.1.34112 WP_000769517.1.3418 WP_000769517.1.34194 WP_000769517.1.34361 WP_000769517.1.3442 WP_000769517.1.34471 WP_000769517.1.34512 WP_000769517.1.34569 WP_000769517.1.34716 WP_000769517.1.34723 WP_000769517.1.3474 WP_000769517.1.34741 WP_000769517.1.34847 WP_000769517.1.34865 WP_000769517.1.34923 WP_000769517.1.34926 WP_000769517.1.34967 WP_000769517.1.35014 WP_000769517.1.35031 WP_000769517.1.35032 WP_000769517.1.35289 WP_000769517.1.35314 WP_000769517.1.35340 WP_000769517.1.35391 WP_000769517.1.35413 WP_000769517.1.35508 WP_000769517.1.35517 WP_000769517.1.35519 WP_000769517.1.35549 WP_000769517.1.35642 WP_000769517.1.35661 WP_000769517.1.35686 WP_000769517.1.35696 WP_000769517.1.35784 WP_000769517.1.3579 WP_000769517.1.35837 WP_000769517.1.35890 WP_000769517.1.35903 WP_000769517.1.36093 WP_000769517.1.36179 WP_000769517.1.36208 WP_000769517.1.36249 WP_000769517.1.36302 WP_000769517.1.36430 WP_000769517.1.36434 WP_000769517.1.36439 WP_000769517.1.36640 WP_000769517.1.36704 WP_000769517.1.36729 WP_000769517.1.36773 WP_000769517.1.36793 WP_000769517.1.36814 WP_000769517.1.36847 WP_000769517.1.36888 WP_000769517.1.36903 WP_000769517.1.36911 WP_000769517.1.3709 WP_000769517.1.37120 WP_000769517.1.37130 WP_000769517.1.37145 WP_000769517.1.37159 WP_000769517.1.3722 WP_000769517.1.37240 WP_000769517.1.37335 WP_000769517.1.37378 WP_000769517.1.37411 WP_000769517.1.37435 WP_000769517.1.37546 WP_000769517.1.37644 WP_000769517.1.37669 WP_000769517.1.37679 WP_000769517.1.3774 WP_000769517.1.37749 WP_000769517.1.37764 WP_000769517.1.37771 WP_000769517.1.37788 WP_000769517.1.37851 WP_000769517.1.37906 WP_000769517.1.37907 WP_000769517.1.37929 WP_000769517.1.38030 WP_000769517.1.38111 WP_000769517.1.38128 WP_000769517.1.38136 WP_000769517.1.38222 WP_000769517.1.38304 WP_000769517.1.38516 WP_000769517.1.38555 WP_000769517.1.38688 WP_000769517.1.3875 WP_000769517.1.38875 WP_000769517.1.38885 WP_000769517.1.38890 WP_000769517.1.38927 WP_000769517.1.39017 WP_000769517.1.39026 WP_000769517.1.39126 WP_000769517.1.39166 WP_000769517.1.39173 WP_000769517.1.39330 WP_000769517.1.39361 WP_000769517.1.39432 WP_000769517.1.39499 WP_000769517.1.39542 WP_000769517.1.39642 WP_000769517.1.39670 WP_000769517.1.39671 WP_000769517.1.39682 WP_000769517.1.39693 WP_000769517.1.39857 WP_000769517.1.39943 WP_000769517.1.39995 WP_000769517.1.40076 WP_000769517.1.4010 WP_000769517.1.40149 WP_000769517.1.40247 WP_000769517.1.40299 WP_000769517.1.40329 WP_000769517.1.40369 WP_000769517.1.40428 WP_000769517.1.40483 WP_000769517.1.40500 WP_000769517.1.40613 WP_000769517.1.40670 WP_000769517.1.40700 WP_000769517.1.40719 WP_000769517.1.40729 WP_000769517.1.40780 WP_000769517.1.40814 WP_000769517.1.40939 WP_000769517.1.40997 WP_000769517.1.41033 WP_000769517.1.41038 WP_000769517.1.4105 WP_000769517.1.41350 WP_000769517.1.41374 WP_000769517.1.41389 WP_000769517.1.41555 WP_000769517.1.41581 WP_000769517.1.41587 WP_000769517.1.41598 WP_000769517.1.41612 WP_000769517.1.41620 WP_000769517.1.41681 WP_000769517.1.4169 WP_000769517.1.41743 WP_000769517.1.41755 WP_000769517.1.41796 WP_000769517.1.4182 WP_000769517.1.41863 WP_000769517.1.41972 WP_000769517.1.42003 WP_000769517.1.42056 WP_000769517.1.42072 WP_000769517.1.42169 WP_000769517.1.42178 WP_000769517.1.42241 WP_000769517.1.4225 WP_000769517.1.42298 WP_000769517.1.42325 WP_000769517.1.42344 WP_000769517.1.42607 WP_000769517.1.42681 WP_000769517.1.42733 WP_000769517.1.42764 WP_000769517.1.42788 WP_000769517.1.42816 WP_000769517.1.42907 WP_000769517.1.42925 WP_000769517.1.42959 WP_000769517.1.42984 WP_000769517.1.42990 WP_000769517.1.43023 WP_000769517.1.43061 WP_000769517.1.43095 WP_000769517.1.43110 WP_000769517.1.43125 WP_000769517.1.43139 WP_000769517.1.43168 WP_000769517.1.43179 WP_000769517.1.43204 WP_000769517.1.43252 WP_000769517.1.43279 WP_000769517.1.43331 WP_000769517.1.43360 WP_000769517.1.43375 WP_000769517.1.43405 WP_000769517.1.43410 WP_000769517.1.43414 WP_000769517.1.43446 WP_000769517.1.43512 WP_000769517.1.43665 WP_000769517.1.43784 WP_000769517.1.4386 WP_000769517.1.43995 WP_000769517.1.44074 WP_000769517.1.44177 WP_000769517.1.44178 WP_000769517.1.44344 WP_000769517.1.44382 WP_000769517.1.44432 WP_000769517.1.44515 WP_000769517.1.44520 WP_000769517.1.44586 WP_000769517.1.44623 WP_000769517.1.44655 WP_000769517.1.44667 WP_000769517.1.447 WP_000769517.1.44714 WP_000769517.1.44715 WP_000769517.1.44856 WP_000769517.1.44868 WP_000769517.1.44876 WP_000769517.1.44892 WP_000769517.1.44940 WP_000769517.1.44993 WP_000769517.1.45042 WP_000769517.1.45080 WP_000769517.1.45091 WP_000769517.1.45094 WP_000769517.1.45132 WP_000769517.1.45140 WP_000769517.1.45157 WP_000769517.1.45162 WP_000769517.1.45223 WP_000769517.1.45242 WP_000769517.1.45267 WP_000769517.1.4527 WP_000769517.1.45281 WP_000769517.1.4545 WP_000769517.1.45450 WP_000769517.1.45456 WP_000769517.1.4546 WP_000769517.1.45542 WP_000769517.1.45555 WP_000769517.1.45574 WP_000769517.1.45610 WP_000769517.1.45620 WP_000769517.1.45645 WP_000769517.1.45698 WP_000769517.1.45705 WP_000769517.1.45763 WP_000769517.1.4577 WP_000769517.1.45773 WP_000769517.1.4582 WP_000769517.1.45859 WP_000769517.1.45862 WP_000769517.1.45874 WP_000769517.1.4597 WP_000769517.1.45972 WP_000769517.1.45977 WP_000769517.1.45979 WP_000769517.1.46037 WP_000769517.1.46050 WP_000769517.1.46062 WP_000769517.1.46078 WP_000769517.1.46171 WP_000769517.1.46172 WP_000769517.1.46185 WP_000769517.1.46248 WP_000769517.1.46333 WP_000769517.1.46339 WP_000769517.1.46353 WP_000769517.1.46529 WP_000769517.1.46619 WP_000769517.1.46648 WP_000769517.1.46720 WP_000769517.1.46736 WP_000769517.1.46770 WP_000769517.1.4680 WP_000769517.1.46906 WP_000769517.1.46914 WP_000769517.1.46929 WP_000769517.1.4694 WP_000769517.1.46947 WP_000769517.1.47002 WP_000769517.1.47107 WP_000769517.1.47111 WP_000769517.1.47282 WP_000769517.1.47334 WP_000769517.1.47459 WP_000769517.1.47522 WP_000769517.1.47617 WP_000769517.1.47669 WP_000769517.1.47680 WP_000769517.1.47747 WP_000769517.1.47851 WP_000769517.1.47908 WP_000769517.1.4792 WP_000769517.1.48046 WP_000769517.1.48064 WP_000769517.1.48067 WP_000769517.1.48116 WP_000769517.1.48142 WP_000769517.1.48156 WP_000769517.1.48187 WP_000769517.1.48223 WP_000769517.1.48272 WP_000769517.1.48282 WP_000769517.1.48310 WP_000769517.1.48338 WP_000769517.1.48376 WP_000769517.1.48398 WP_000769517.1.4840 WP_000769517.1.48427 WP_000769517.1.48437 WP_000769517.1.48438 WP_000769517.1.48479 WP_000769517.1.4852 WP_000769517.1.48580 WP_000769517.1.48664 WP_000769517.1.48670 WP_000769517.1.48723 WP_000769517.1.48769 WP_000769517.1.48782 WP_000769517.1.48817 WP_000769517.1.48869 WP_000769517.1.49018 WP_000769517.1.49032 WP_000769517.1.49071 WP_000769517.1.49094 WP_000769517.1.49105 WP_000769517.1.49171 WP_000769517.1.49189 WP_000769517.1.49196 WP_000769517.1.49199 WP_000769517.1.4924 WP_000769517.1.49257 WP_000769517.1.49301 WP_000769517.1.49326 WP_000769517.1.49362 WP_000769517.1.49418 WP_000769517.1.4945 WP_000769517.1.49479 WP_000769517.1.49518 WP_000769517.1.49549 WP_000769517.1.49581 WP_000769517.1.49582 WP_000769517.1.496 WP_000769517.1.49603 WP_000769517.1.49643 WP_000769517.1.49672 WP_000769517.1.49690 WP_000769517.1.49728 WP_000769517.1.49732 WP_000769517.1.49745 WP_000769517.1.49819 WP_000769517.1.49918 WP_000769517.1.49935 WP_000769517.1.50028 WP_000769517.1.50117 WP_000769517.1.50145 WP_000769517.1.50178 WP_000769517.1.50192 WP_000769517.1.50291 WP_000769517.1.50367 WP_000769517.1.50388 WP_000769517.1.5045 WP_000769517.1.50464 WP_000769517.1.50477 WP_000769517.1.50525 WP_000769517.1.50558 WP_000769517.1.50568 WP_000769517.1.5059 WP_000769517.1.50594 WP_000769517.1.50647 WP_000769517.1.50699 WP_000769517.1.50740 WP_000769517.1.50817 WP_000769517.1.50829 WP_000769517.1.50974 WP_000769517.1.51015 WP_000769517.1.5108 WP_000769517.1.51130 WP_000769517.1.51209 WP_000769517.1.51226 WP_000769517.1.51271 WP_000769517.1.51277 WP_000769517.1.51326 WP_000769517.1.51393 WP_000769517.1.51496 WP_000769517.1.51557 WP_000769517.1.51741 WP_000769517.1.51794 WP_000769517.1.51824 WP_000769517.1.52034 WP_000769517.1.52061 WP_000769517.1.52072 WP_000769517.1.52195 WP_000769517.1.52198 WP_000769517.1.52210 WP_000769517.1.52289 WP_000769517.1.52308 WP_000769517.1.52343 WP_000769517.1.52377 WP_000769517.1.52396 WP_000769517.1.52427 WP_000769517.1.52452 WP_000769517.1.5251 WP_000769517.1.52511 WP_000769517.1.52605 WP_000769517.1.52830 WP_000769517.1.52889 WP_000769517.1.52900 WP_000769517.1.52965 WP_000769517.1.52983 WP_000769517.1.5304 WP_000769517.1.53050 WP_000769517.1.53057 WP_000769517.1.5319 WP_000769517.1.53245 WP_000769517.1.53312 WP_000769517.1.53363 WP_000769517.1.53373 WP_000769517.1.53379 WP_000769517.1.53408 WP_000769517.1.53467 WP_000769517.1.5347 WP_000769517.1.53532 WP_000769517.1.53759 WP_000769517.1.53774 WP_000769517.1.53799 WP_000769517.1.53911 WP_000769517.1.53926 WP_000769517.1.54049 WP_000769517.1.54074 WP_000769517.1.54086 WP_000769517.1.54237 WP_000769517.1.54290 WP_000769517.1.54299 WP_000769517.1.54404 WP_000769517.1.54438 WP_000769517.1.54471 WP_000769517.1.54479 WP_000769517.1.54485 WP_000769517.1.54574 WP_000769517.1.54744 WP_000769517.1.54830 WP_000769517.1.54851 WP_000769517.1.54929 WP_000769517.1.54931 WP_000769517.1.54967 WP_000769517.1.54990 WP_000769517.1.5500 WP_000769517.1.55004 WP_000769517.1.55082 WP_000769517.1.55095 WP_000769517.1.55139 WP_000769517.1.5518 WP_000769517.1.552 WP_000769517.1.55239 WP_000769517.1.55271 WP_000769517.1.55327 WP_000769517.1.55336 WP_000769517.1.55419 WP_000769517.1.55495 WP_000769517.1.5550 WP_000769517.1.55527 WP_000769517.1.55535 WP_000769517.1.55603 WP_000769517.1.55719 WP_000769517.1.55724 WP_000769517.1.55845 WP_000769517.1.55955 WP_000769517.1.56003 WP_000769517.1.5604 WP_000769517.1.56064 WP_000769517.1.56106 WP_000769517.1.56135 WP_000769517.1.56159 WP_000769517.1.56200 WP_000769517.1.56220 WP_000769517.1.56237 WP_000769517.1.56265 WP_000769517.1.56387 WP_000769517.1.56464 WP_000769517.1.56482 WP_000769517.1.56527 WP_000769517.1.56542 WP_000769517.1.56608 WP_000769517.1.56619 WP_000769517.1.56702 WP_000769517.1.56708 WP_000769517.1.56737 WP_000769517.1.5675 WP_000769517.1.56822 WP_000769517.1.56903 WP_000769517.1.56931 WP_000769517.1.56966 WP_000769517.1.56975 WP_000769517.1.57015 WP_000769517.1.5705 WP_000769517.1.57081 WP_000769517.1.57115 WP_000769517.1.57141 WP_000769517.1.57330 WP_000769517.1.57427 WP_000769517.1.57448 WP_000769517.1.57593 WP_000769517.1.57670 WP_000769517.1.57693 WP_000769517.1.57701 WP_000769517.1.57718 WP_000769517.1.57727 WP_000769517.1.57745 WP_000769517.1.57783 WP_000769517.1.57962 WP_000769517.1.5799 WP_000769517.1.58006 WP_000769517.1.58051 WP_000769517.1.58122 WP_000769517.1.5817 WP_000769517.1.58185 WP_000769517.1.58198 WP_000769517.1.58241 WP_000769517.1.58246 WP_000769517.1.58321 WP_000769517.1.58325 WP_000769517.1.58350 WP_000769517.1.58353 WP_000769517.1.58366 WP_000769517.1.58373 WP_000769517.1.58392 WP_000769517.1.58421 WP_000769517.1.58481 WP_000769517.1.5849 WP_000769517.1.58508 WP_000769517.1.58521 WP_000769517.1.586 WP_000769517.1.58603 WP_000769517.1.58714 WP_000769517.1.58775 WP_000769517.1.58936 WP_000769517.1.58998 WP_000769517.1.5901 WP_000769517.1.5904 WP_000769517.1.59133 WP_000769517.1.59187 WP_000769517.1.5925 WP_000769517.1.59269 WP_000769517.1.59284 WP_000769517.1.59327 WP_000769517.1.59363 WP_000769517.1.59397 WP_000769517.1.59457 WP_000769517.1.59459 WP_000769517.1.59467 WP_000769517.1.59478 WP_000769517.1.59603 WP_000769517.1.59609 WP_000769517.1.59629 WP_000769517.1.59643 WP_000769517.1.59663 WP_000769517.1.59697 WP_000769517.1.59736 WP_000769517.1.59803 WP_000769517.1.59881 WP_000769517.1.59886 WP_000769517.1.59977 WP_000769517.1.60022 WP_000769517.1.60086 WP_000769517.1.60156 WP_000769517.1.60181 WP_000769517.1.60251 WP_000769517.1.60259 WP_000769517.1.60280 WP_000769517.1.60307 WP_000769517.1.60368 WP_000769517.1.60462 WP_000769517.1.60515 WP_000769517.1.60551 WP_000769517.1.60594 WP_000769517.1.60690 WP_000769517.1.60696 WP_000769517.1.60787 WP_000769517.1.60898 WP_000769517.1.60939 WP_000769517.1.60981 WP_000769517.1.61030 WP_000769517.1.61119 WP_000769517.1.61152 WP_000769517.1.61153 WP_000769517.1.6118 WP_000769517.1.61188 WP_000769517.1.61257 WP_000769517.1.61324 WP_000769517.1.61339 WP_000769517.1.61394 WP_000769517.1.61408 WP_000769517.1.61421 WP_000769517.1.61547 WP_000769517.1.61591 WP_000769517.1.6168 WP_000769517.1.61784 WP_000769517.1.61910 WP_000769517.1.61970 WP_000769517.1.62030 WP_000769517.1.6208 WP_000769517.1.62093 WP_000769517.1.62140 WP_000769517.1.62164 WP_000769517.1.62367 WP_000769517.1.62409 WP_000769517.1.62459 WP_000769517.1.62537 WP_000769517.1.62539 WP_000769517.1.62575 WP_000769517.1.62685 WP_000769517.1.62740 WP_000769517.1.62756 WP_000769517.1.62781 WP_000769517.1.62796 WP_000769517.1.62808 WP_000769517.1.62829 WP_000769517.1.62842 WP_000769517.1.62878 WP_000769517.1.62956 WP_000769517.1.63011 WP_000769517.1.63050 WP_000769517.1.63068 WP_000769517.1.631 WP_000769517.1.63132 WP_000769517.1.63182 WP_000769517.1.63195 WP_000769517.1.63215 WP_000769517.1.63233 WP_000769517.1.63244 WP_000769517.1.63273 WP_000769517.1.63279 WP_000769517.1.63296 WP_000769517.1.63307 WP_000769517.1.63319 WP_000769517.1.63324 WP_000769517.1.63335 WP_000769517.1.63337 WP_000769517.1.63383 WP_000769517.1.63406 WP_000769517.1.63411 WP_000769517.1.63421 WP_000769517.1.63460 WP_000769517.1.63510 WP_000769517.1.63527 WP_000769517.1.63565 WP_000769517.1.63617 WP_000769517.1.63693 WP_000769517.1.63705 WP_000769517.1.6378 WP_000769517.1.63847 WP_000769517.1.63894 WP_000769517.1.64012 WP_000769517.1.64094 WP_000769517.1.64108 WP_000769517.1.64207 WP_000769517.1.64251 WP_000769517.1.64303 WP_000769517.1.64368 WP_000769517.1.64628 WP_000769517.1.64665 WP_000769517.1.64811 WP_000769517.1.64845 WP_000769517.1.64860 WP_000769517.1.64951 WP_000769517.1.64956 WP_000769517.1.64996 WP_000769517.1.64998 WP_000769517.1.65025 WP_000769517.1.65038 WP_000769517.1.65076 WP_000769517.1.65233 WP_000769517.1.65264 WP_000769517.1.65358 WP_000769517.1.65387 WP_000769517.1.65406 WP_000769517.1.65407 WP_000769517.1.6544 WP_000769517.1.65448 WP_000769517.1.65585 WP_000769517.1.65616 WP_000769517.1.65629 WP_000769517.1.65643 WP_000769517.1.65656 WP_000769517.1.6568 WP_000769517.1.65713 WP_000769517.1.65734 WP_000769517.1.65769 WP_000769517.1.65809 WP_000769517.1.6585 WP_000769517.1.65892 WP_000769517.1.65935 WP_000769517.1.65947 WP_000769517.1.65965 WP_000769517.1.6603 WP_000769517.1.66054 WP_000769517.1.66069 WP_000769517.1.66073 WP_000769517.1.66130 WP_000769517.1.66144 WP_000769517.1.66298 WP_000769517.1.6632 WP_000769517.1.66366 WP_000769517.1.66453 WP_000769517.1.66513 WP_000769517.1.66556 WP_000769517.1.66598 WP_000769517.1.66611 WP_000769517.1.66614 WP_000769517.1.66705 WP_000769517.1.66756 WP_000769517.1.66766 WP_000769517.1.66816 WP_000769517.1.6688 WP_000769517.1.66938 WP_000769517.1.66969 WP_000769517.1.67012 WP_000769517.1.67014 WP_000769517.1.67067 WP_000769517.1.67072 WP_000769517.1.67113 WP_000769517.1.67155 WP_000769517.1.67160 WP_000769517.1.67238 WP_000769517.1.67251 WP_000769517.1.67259 WP_000769517.1.6726 WP_000769517.1.67286 WP_000769517.1.67294 WP_000769517.1.67312 WP_000769517.1.67328 WP_000769517.1.67418 WP_000769517.1.67420 WP_000769517.1.67425 WP_000769517.1.67457 WP_000769517.1.67460 WP_000769517.1.67540 WP_000769517.1.67571 WP_000769517.1.67621 WP_000769517.1.67644 WP_000769517.1.67653 WP_000769517.1.67691 WP_000769517.1.67806 WP_000769517.1.67834 WP_000769517.1.67867 WP_000769517.1.67880 WP_000769517.1.67900 WP_000769517.1.67991 WP_000769517.1.68101 WP_000769517.1.68134 WP_000769517.1.68141 WP_000769517.1.68152 WP_000769517.1.68202 WP_000769517.1.68221 WP_000769517.1.68223 WP_000769517.1.6824 WP_000769517.1.68268 WP_000769517.1.68299 WP_000769517.1.68355 WP_000769517.1.68366 WP_000769517.1.68398 WP_000769517.1.68399 WP_000769517.1.68476 WP_000769517.1.68479 WP_000769517.1.68504 WP_000769517.1.68512 WP_000769517.1.68548 WP_000769517.1.686 WP_000769517.1.68681 WP_000769517.1.68683 WP_000769517.1.68741 WP_000769517.1.68743 WP_000769517.1.68883 WP_000769517.1.68998 WP_000769517.1.69012 WP_000769517.1.69071 WP_000769517.1.69078 WP_000769517.1.69105 WP_000769517.1.6915 WP_000769517.1.69198 WP_000769517.1.69213 WP_000769517.1.69349 WP_000769517.1.69394 WP_000769517.1.69437 WP_000769517.1.69475 WP_000769517.1.69490 WP_000769517.1.69546 WP_000769517.1.69598 WP_000769517.1.6968 WP_000769517.1.69683 WP_000769517.1.69724 WP_000769517.1.69734 WP_000769517.1.6980 WP_000769517.1.69820 WP_000769517.1.69823 WP_000769517.1.69830 WP_000769517.1.69882 WP_000769517.1.699 WP_000769517.1.69902 WP_000769517.1.69934 WP_000769517.1.69980 WP_000769517.1.69995 WP_000769517.1.70059 WP_000769517.1.70161 WP_000769517.1.70220 WP_000769517.1.70225 WP_000769517.1.70228 WP_000769517.1.70294 WP_000769517.1.70311 WP_000769517.1.70313 WP_000769517.1.70334 WP_000769517.1.70353 WP_000769517.1.70448 WP_000769517.1.7046 WP_000769517.1.70487 WP_000769517.1.70495 WP_000769517.1.70527 WP_000769517.1.70554 WP_000769517.1.70558 WP_000769517.1.70564 WP_000769517.1.7064 WP_000769517.1.70664 WP_000769517.1.707 WP_000769517.1.70721 WP_000769517.1.70763 WP_000769517.1.70808 WP_000769517.1.70835 WP_000769517.1.70843 WP_000769517.1.70909 WP_000769517.1.70926 WP_000769517.1.710 WP_000769517.1.71016 WP_000769517.1.7105 WP_000769517.1.71208 WP_000769517.1.71231 WP_000769517.1.71267 WP_000769517.1.71313 WP_000769517.1.71410 WP_000769517.1.71467 WP_000769517.1.71475 WP_000769517.1.71715 WP_000769517.1.71721 WP_000769517.1.71737 WP_000769517.1.71739 WP_000769517.1.71741 WP_000769517.1.71863 WP_000769517.1.71877 WP_000769517.1.71892 WP_000769517.1.71899 WP_000769517.1.71910 WP_000769517.1.71978 WP_000769517.1.72002 WP_000769517.1.72018 WP_000769517.1.72085 WP_000769517.1.72148 WP_000769517.1.722 WP_000769517.1.72204 WP_000769517.1.72306 WP_000769517.1.72340 WP_000769517.1.72363 WP_000769517.1.72371 WP_000769517.1.72453 WP_000769517.1.72465 WP_000769517.1.72497 WP_000769517.1.72564 WP_000769517.1.7258 WP_000769517.1.7260 WP_000769517.1.72649 WP_000769517.1.72666 WP_000769517.1.72708 WP_000769517.1.72719 WP_000769517.1.72753 WP_000769517.1.72762 WP_000769517.1.72881 WP_000769517.1.72930 WP_000769517.1.72961 WP_000769517.1.72991 WP_000769517.1.73021 WP_000769517.1.73087 WP_000769517.1.73140 WP_000769517.1.73190 WP_000769517.1.73195 WP_000769517.1.73201 WP_000769517.1.73211 WP_000769517.1.73240 WP_000769517.1.73241 WP_000769517.1.73264 WP_000769517.1.73401 WP_000769517.1.73420 WP_000769517.1.73450 WP_000769517.1.73464 WP_000769517.1.73513 WP_000769517.1.73539 WP_000769517.1.7360 WP_000769517.1.73610 WP_000769517.1.7365 WP_000769517.1.73674 WP_000769517.1.73694 WP_000769517.1.73740 WP_000769517.1.73789 WP_000769517.1.73885 WP_000769517.1.73900 WP_000769517.1.73921 WP_000769517.1.73940 WP_000769517.1.73949 WP_000769517.1.73971 WP_000769517.1.74004 WP_000769517.1.7401 WP_000769517.1.7406 WP_000769517.1.74073 WP_000769517.1.74085 WP_000769517.1.74257 WP_000769517.1.74284 WP_000769517.1.74295 WP_000769517.1.74327 WP_000769517.1.74456 WP_000769517.1.74468 WP_000769517.1.74576 WP_000769517.1.74676 WP_000769517.1.74681 WP_000769517.1.74770 WP_000769517.1.74785 WP_000769517.1.74797 WP_000769517.1.7482 WP_000769517.1.74846 WP_000769517.1.74874 WP_000769517.1.75070 WP_000769517.1.75111 WP_000769517.1.75131 WP_000769517.1.75323 WP_000769517.1.75351 WP_000769517.1.75356 WP_000769517.1.75409 WP_000769517.1.75538 WP_000769517.1.75566 WP_000769517.1.75571 WP_000769517.1.75647 WP_000769517.1.75692 WP_000769517.1.75728 WP_000769517.1.75743 WP_000769517.1.75809 WP_000769517.1.75840 WP_000769517.1.75848 WP_000769517.1.75862 WP_000769517.1.75910 WP_000769517.1.76013 WP_000769517.1.7602 WP_000769517.1.76047 WP_000769517.1.76049 WP_000769517.1.76050 WP_000769517.1.76053 WP_000769517.1.76114 WP_000769517.1.76121 WP_000769517.1.76153 WP_000769517.1.76179 WP_000769517.1.7627 WP_000769517.1.76283 WP_000769517.1.76313 WP_000769517.1.76424 WP_000769517.1.76426 WP_000769517.1.76431 WP_000769517.1.76463 WP_000769517.1.76482 WP_000769517.1.76497 WP_000769517.1.76674 WP_000769517.1.76711 WP_000769517.1.76718 WP_000769517.1.76798 WP_000769517.1.76803 WP_000769517.1.76829 WP_000769517.1.7694 WP_000769517.1.77043 WP_000769517.1.77072 WP_000769517.1.77137 WP_000769517.1.77158 WP_000769517.1.77187 WP_000769517.1.77190 WP_000769517.1.77203 WP_000769517.1.77229 WP_000769517.1.77297 WP_000769517.1.77298 WP_000769517.1.77331 WP_000769517.1.77346 WP_000769517.1.77359 WP_000769517.1.77388 WP_000769517.1.77498 WP_000769517.1.77532 WP_000769517.1.77650 WP_000769517.1.77735 WP_000769517.1.77791 WP_000769517.1.7785 WP_000769517.1.7786 WP_000769517.1.77882 WP_000769517.1.77893 WP_000769517.1.77915 WP_000769517.1.77922 WP_000769517.1.77930 WP_000769517.1.77986 WP_000769517.1.78038 WP_000769517.1.78082 WP_000769517.1.78093 WP_000769517.1.78164 WP_000769517.1.78179 WP_000769517.1.78194 WP_000769517.1.78304 WP_000769517.1.78330 WP_000769517.1.78335 WP_000769517.1.78371 WP_000769517.1.78434 WP_000769517.1.78436 WP_000769517.1.78470 WP_000769517.1.78489 WP_000769517.1.78494 WP_000769517.1.7853 WP_000769517.1.78573 WP_000769517.1.78585 WP_000769517.1.78592 WP_000769517.1.78662 WP_000769517.1.78736 WP_000769517.1.78758 WP_000769517.1.78763 WP_000769517.1.78816 WP_000769517.1.78920 WP_000769517.1.78937 WP_000769517.1.78991 WP_000769517.1.78995 WP_000769517.1.7905 WP_000769517.1.79110 WP_000769517.1.7914 WP_000769517.1.79143 WP_000769517.1.79178 WP_000769517.1.79192 WP_000769517.1.79275 WP_000769517.1.79285 WP_000769517.1.79378 WP_000769517.1.79552 WP_000769517.1.79581 WP_000769517.1.79627 WP_000769517.1.79677 WP_000769517.1.79731 WP_000769517.1.79763 WP_000769517.1.7981 WP_000769517.1.79815 WP_000769517.1.79904 WP_000769517.1.79949 WP_000769517.1.80009 WP_000769517.1.80013 WP_000769517.1.80029 WP_000769517.1.80086 WP_000769517.1.80119 WP_000769517.1.80120 WP_000769517.1.80122 WP_000769517.1.80146 WP_000769517.1.80178 WP_000769517.1.80184 WP_000769517.1.80210 WP_000769517.1.80244 WP_000769517.1.80274 WP_000769517.1.80316 WP_000769517.1.80361 WP_000769517.1.80389 WP_000769517.1.8040 WP_000769517.1.80434 WP_000769517.1.8045 WP_000769517.1.80521 WP_000769517.1.80582 WP_000769517.1.80745 WP_000769517.1.80899 WP_000769517.1.81022 WP_000769517.1.81049 WP_000769517.1.81095 WP_000769517.1.81132 WP_000769517.1.81151 WP_000769517.1.81172 WP_000769517.1.81176 WP_000769517.1.81184 WP_000769517.1.81228 WP_000769517.1.81232 WP_000769517.1.81288 WP_000769517.1.81290 WP_000769517.1.81379 WP_000769517.1.81508 WP_000769517.1.81574 WP_000769517.1.8160 WP_000769517.1.81604 WP_000769517.1.81619 WP_000769517.1.81645 WP_000769517.1.8180 WP_000769517.1.81838 WP_000769517.1.8185 WP_000769517.1.81969 WP_000769517.1.81990 WP_000769517.1.8206 WP_000769517.1.82103 WP_000769517.1.8213 WP_000769517.1.82174 WP_000769517.1.82184 WP_000769517.1.82253 WP_000769517.1.82281 WP_000769517.1.82301 WP_000769517.1.82349 WP_000769517.1.82406 WP_000769517.1.82458 WP_000769517.1.82468 WP_000769517.1.82525 WP_000769517.1.82535 WP_000769517.1.82558 WP_000769517.1.8266 WP_000769517.1.82678 WP_000769517.1.82768 WP_000769517.1.82824 WP_000769517.1.82855 WP_000769517.1.82930 WP_000769517.1.82941 WP_000769517.1.83046 WP_000769517.1.83054 WP_000769517.1.83078 WP_000769517.1.83086 WP_000769517.1.83103 WP_000769517.1.8318 WP_000769517.1.83203 WP_000769517.1.83291 WP_000769517.1.83359 WP_000769517.1.83405 WP_000769517.1.83417 WP_000769517.1.8346 WP_000769517.1.83467 WP_000769517.1.83472 WP_000769517.1.83479 WP_000769517.1.83520 WP_000769517.1.83553 WP_000769517.1.8366 WP_000769517.1.83674 WP_000769517.1.83728 WP_000769517.1.83750 WP_000769517.1.83756 WP_000769517.1.83758 WP_000769517.1.83788 WP_000769517.1.83797 WP_000769517.1.83844 WP_000769517.1.8385 WP_000769517.1.83886 WP_000769517.1.83989 WP_000769517.1.84025 WP_000769517.1.84054 WP_000769517.1.84129 WP_000769517.1.84161 WP_000769517.1.84188 WP_000769517.1.84275 WP_000769517.1.84415 WP_000769517.1.84418 WP_000769517.1.84590 WP_000769517.1.84596 WP_000769517.1.84608 WP_000769517.1.84648 WP_000769517.1.84651 WP_000769517.1.84696 WP_000769517.1.84826 WP_000769517.1.84847 WP_000769517.1.84854 WP_000769517.1.84924 WP_000769517.1.8496 WP_000769517.1.84975 WP_000769517.1.84978 WP_000769517.1.85017 WP_000769517.1.85026 WP_000769517.1.85045 WP_000769517.1.85070 WP_000769517.1.85118 WP_000769517.1.85229 WP_000769517.1.85289 WP_000769517.1.85375 WP_000769517.1.85376 WP_000769517.1.85409 WP_000769517.1.85441 WP_000769517.1.85485 WP_000769517.1.85585 WP_000769517.1.85611 WP_000769517.1.85730 WP_000769517.1.85732 WP_000769517.1.85858 WP_000769517.1.85906 WP_000769517.1.85924 WP_000769517.1.85980 WP_000769517.1.86036 WP_000769517.1.86042 WP_000769517.1.86086 WP_000769517.1.862 WP_000769517.1.86209 WP_000769517.1.86281 WP_000769517.1.86315 WP_000769517.1.8636 WP_000769517.1.86363 WP_000769517.1.86390 WP_000769517.1.86473 WP_000769517.1.86531 WP_000769517.1.86664 WP_000769517.1.86704 WP_000769517.1.86736 WP_000769517.1.86745 WP_000769517.1.86779 WP_000769517.1.86793 WP_000769517.1.86795 WP_000769517.1.8690 WP_000769517.1.86968 WP_000769517.1.86999 WP_000769517.1.87088 WP_000769517.1.87097 WP_000769517.1.87100 WP_000769517.1.87133 WP_000769517.1.87137 WP_000769517.1.87168 WP_000769517.1.87190 WP_000769517.1.87204 WP_000769517.1.87221 WP_000769517.1.87296 WP_000769517.1.87363 WP_000769517.1.87372 WP_000769517.1.87388 WP_000769517.1.87486 WP_000769517.1.87511 WP_000769517.1.87541 WP_000769517.1.87595 WP_000769517.1.8764 WP_000769517.1.87734 WP_000769517.1.87745 WP_000769517.1.87841 WP_000769517.1.87854 WP_000769517.1.87865 WP_000769517.1.87937 WP_000769517.1.87967 WP_000769517.1.88169 WP_000769517.1.88309 WP_000769517.1.88375 WP_000769517.1.88418 WP_000769517.1.88430 WP_000769517.1.88440 WP_000769517.1.88449 WP_000769517.1.8847 WP_000769517.1.88560 WP_000769517.1.88563 WP_000769517.1.88585 WP_000769517.1.8859 WP_000769517.1.88600 WP_000769517.1.88614 WP_000769517.1.88696 WP_000769517.1.88771 WP_000769517.1.88781 WP_000769517.1.88843 WP_000769517.1.88878 WP_000769517.1.88954 WP_000769517.1.88960 WP_000769517.1.88962 WP_000769517.1.89012 WP_000769517.1.89024 WP_000769517.1.89036 WP_000769517.1.89125 WP_000769517.1.8918 WP_000769517.1.89184 WP_000769517.1.89262 WP_000769517.1.89290 WP_000769517.1.89348 WP_000769517.1.89350 WP_000769517.1.89390 WP_000769517.1.89404 WP_000769517.1.89433 WP_000769517.1.89779 WP_000769517.1.89794 WP_000769517.1.898 WP_000769517.1.89863 WP_000769517.1.89908 WP_000769517.1.89949 WP_000769517.1.89950 WP_000769517.1.90069 WP_000769517.1.90173 WP_000769517.1.90174 WP_000769517.1.90217 WP_000769517.1.90246 WP_000769517.1.90250 WP_000769517.1.90386 WP_000769517.1.90447 WP_000769517.1.90475 WP_000769517.1.90506 WP_000769517.1.90517 WP_000769517.1.90533 WP_000769517.1.90556 WP_000769517.1.90661 WP_000769517.1.90698 WP_000769517.1.9076 WP_000769517.1.91005 WP_000769517.1.91019 WP_000769517.1.91150 WP_000769517.1.9122 WP_000769517.1.91280 WP_000769517.1.91287 WP_000769517.1.91447 WP_000769517.1.91486 WP_000769517.1.91525 WP_000769517.1.91530 WP_000769517.1.9155 WP_000769517.1.91586 WP_000769517.1.91611 WP_000769517.1.91634 WP_000769517.1.91670 WP_000769517.1.917 WP_000769517.1.91704 WP_000769517.1.91745 WP_000769517.1.91848 WP_000769517.1.91918 WP_000769517.1.91969 WP_000769517.1.92125 WP_000769517.1.92186 WP_000769517.1.92212 WP_000769517.1.92228 WP_000769517.1.92244 WP_000769517.1.92249 WP_000769517.1.92303 WP_000769517.1.92391 WP_000769517.1.92405 WP_000769517.1.92425 WP_000769517.1.9247 WP_000769517.1.92512 WP_000769517.1.92667 WP_000769517.1.92674 WP_000769517.1.92718 WP_000769517.1.92765 WP_000769517.1.92795 WP_000769517.1.9286 WP_000769517.1.92937 WP_000769517.1.9296 WP_000769517.1.92965 WP_000769517.1.92997 WP_000769517.1.93047 WP_000769517.1.93071 WP_000769517.1.93147 WP_000769517.1.93197 WP_000769517.1.93237 WP_000769517.1.93243 WP_000769517.1.93254 WP_000769517.1.93260 WP_000769517.1.93378 WP_000769517.1.93471 WP_000769517.1.93567 WP_000769517.1.93579 WP_000769517.1.93708 WP_000769517.1.93758 WP_000769517.1.93762 WP_000769517.1.93775 WP_000769517.1.93890 WP_000769517.1.94 WP_000769517.1.94053 WP_000769517.1.94080 WP_000769517.1.94122 WP_000769517.1.94123 WP_000769517.1.94130 WP_000769517.1.94242 WP_000769517.1.94245 WP_000769517.1.94248 WP_000769517.1.94268 WP_000769517.1.94287 WP_000769517.1.9430 WP_000769517.1.94320 WP_000769517.1.94337 WP_000769517.1.94341 WP_000769517.1.94484 WP_000769517.1.94505 WP_000769517.1.94536 WP_000769517.1.9455 WP_000769517.1.947 WP_000769517.1.94825 WP_000769517.1.94969 WP_000769517.1.95008 WP_000769517.1.95023 WP_000769517.1.95029 WP_000769517.1.95033 WP_000769517.1.95156 WP_000769517.1.95193 WP_000769517.1.95263 WP_000769517.1.95281 WP_000769517.1.95294 WP_000769517.1.95386 WP_000769517.1.95415 WP_000769517.1.95494 WP_000769517.1.95512 WP_000769517.1.95519 WP_000769517.1.95522 WP_000769517.1.95560 WP_000769517.1.9563 WP_000769517.1.95683 WP_000769517.1.95780 WP_000769517.1.95804 WP_000769517.1.95832 WP_000769517.1.959 WP_000769517.1.95962 WP_000769517.1.96160 WP_000769517.1.96165 WP_000769517.1.96209 WP_000769517.1.96218 WP_000769517.1.96271 WP_000769517.1.96305 WP_000769517.1.96316 WP_000769517.1.96468 WP_000769517.1.96568 WP_000769517.1.96646 WP_000769517.1.96727 WP_000769517.1.96770 WP_000769517.1.96804 WP_000769517.1.96854 WP_000769517.1.96882 WP_000769517.1.96895 WP_000769517.1.96918 WP_000769517.1.9695 WP_000769517.1.96976 WP_000769517.1.97001 WP_000769517.1.97007 WP_000769517.1.97019 WP_000769517.1.97072 WP_000769517.1.97117 WP_000769517.1.97138 WP_000769517.1.97191 WP_000769517.1.97267 WP_000769517.1.97295 WP_000769517.1.97411 WP_000769517.1.97536 WP_000769517.1.97574 WP_000769517.1.97627 WP_000769517.1.97731 WP_000769517.1.97739 WP_000769517.1.97758 WP_000769517.1.97786 WP_000769517.1.97827 WP_000769517.1.97835 WP_000769517.1.9789 WP_000769517.1.97899 WP_000769517.1.97928 WP_000769517.1.97999 WP_000769517.1.98011 WP_000769517.1.98033 WP_000769517.1.98051 WP_000769517.1.98242 WP_000769517.1.98361 WP_000769517.1.98379 WP_000769517.1.98411 WP_000769517.1.98456 WP_000769517.1.98512 WP_000769517.1.98552 WP_000769517.1.986 WP_000769517.1.98655 WP_000769517.1.98706 WP_000769517.1.98767 WP_000769517.1.98837 WP_000769517.1.98858 WP_000769517.1.98874 WP_000769517.1.98967 WP_000769517.1.99009 WP_000769517.1.99025 WP_000769517.1.99155 WP_000769517.1.99171 WP_000769517.1.99249 WP_000769517.1.99280 WP_000769517.1.99311 WP_000769517.1.99359 WP_000769517.1.9936 WP_000769517.1.99405 WP_000769517.1.99430 WP_000769517.1.99459 WP_000769517.1.99492 WP_000769517.1.99519 WP_000769517.1.99536 WP_000769517.1.99538 WP_000769517.1.99564 WP_000769517.1.99569 WP_000769517.1.9960 WP_000769517.1.99631 WP_000769517.1.99638 WP_000769517.1.99686 WP_000769517.1.99759 WP_000769517.1.99802 WP_000769517.1.99850 WP_000769517.1.99860 WP_000769517.1.9987 WP_000769517.1.99926 WP_000769517.1.99956 WP_000769517.1.99979 WP_000769517.1.99985 YP_501011.1.76163 gi|521213037|ref|YP_008169383.1| gi|479330278|ref|YP_007869337.1| gi|87160588|ref|YP_494865.1| gi|554645173|ref|YP_008716964.1| gi|385782513|ref|YP_005758684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]