SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|521213167|ref|YP_008169513.1| from Staphylococcus aureus Bmb9393

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521213167|ref|YP_008169513.1|
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.97e-62
Family Phosphate binding protein-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|521213167|ref|YP_008169513.1|
Sequence length 259
Comment Amino-acid ABC transporter-binding protein [Staphylococcus aureus Bmb9393]
Sequence
MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
GELAKIGKKWFGQDVSKSK
Download sequence
Identical sequences A0A0E1AJD6 A0A0E1VN00 A0A0H2WX83 A0A0H2XK42 A0A0H3JY71 A0A0H3KAB2 A0A1E8WNU5 A0A2K4E6E1 Q2FVL2 X5EJN4
gi|387144113|ref|YP_005732507.1| gi|21284065|ref|NP_647153.1| gi|151222525|ref|YP_001333347.1| gi|384870965|ref|YP_005753679.1| gi|379015534|ref|YP_005291770.1| WP_000825929.1.100013 WP_000825929.1.100041 WP_000825929.1.100049 WP_000825929.1.100057 WP_000825929.1.100067 WP_000825929.1.100072 WP_000825929.1.100088 WP_000825929.1.100090 WP_000825929.1.100094 WP_000825929.1.100122 WP_000825929.1.100154 WP_000825929.1.100180 WP_000825929.1.100189 WP_000825929.1.100298 WP_000825929.1.100307 WP_000825929.1.100310 WP_000825929.1.100335 WP_000825929.1.100352 WP_000825929.1.100391 WP_000825929.1.10041 WP_000825929.1.100618 WP_000825929.1.100631 WP_000825929.1.100647 WP_000825929.1.100665 WP_000825929.1.100761 WP_000825929.1.100768 WP_000825929.1.100834 WP_000825929.1.100903 WP_000825929.1.100920 WP_000825929.1.100922 WP_000825929.1.100963 WP_000825929.1.100981 WP_000825929.1.100987 WP_000825929.1.101017 WP_000825929.1.101084 WP_000825929.1.101177 WP_000825929.1.101240 WP_000825929.1.101266 WP_000825929.1.101298 WP_000825929.1.101327 WP_000825929.1.101330 WP_000825929.1.101375 WP_000825929.1.101393 WP_000825929.1.101406 WP_000825929.1.101490 WP_000825929.1.101505 WP_000825929.1.101511 WP_000825929.1.101566 WP_000825929.1.101570 WP_000825929.1.101598 WP_000825929.1.101615 WP_000825929.1.101617 WP_000825929.1.10166 WP_000825929.1.101725 WP_000825929.1.101757 WP_000825929.1.101788 WP_000825929.1.101922 WP_000825929.1.101950 WP_000825929.1.102066 WP_000825929.1.1022 WP_000825929.1.10232 WP_000825929.1.10397 WP_000825929.1.10431 WP_000825929.1.10486 WP_000825929.1.10503 WP_000825929.1.1052 WP_000825929.1.10542 WP_000825929.1.10543 WP_000825929.1.10565 WP_000825929.1.10583 WP_000825929.1.10614 WP_000825929.1.10644 WP_000825929.1.10679 WP_000825929.1.10707 WP_000825929.1.10726 WP_000825929.1.10742 WP_000825929.1.10841 WP_000825929.1.1087 WP_000825929.1.10950 WP_000825929.1.11129 WP_000825929.1.1120 WP_000825929.1.11228 WP_000825929.1.11287 WP_000825929.1.11294 WP_000825929.1.11348 WP_000825929.1.11353 WP_000825929.1.1136 WP_000825929.1.11377 WP_000825929.1.11407 WP_000825929.1.11488 WP_000825929.1.11492 WP_000825929.1.11525 WP_000825929.1.11558 WP_000825929.1.11592 WP_000825929.1.11655 WP_000825929.1.11665 WP_000825929.1.11692 WP_000825929.1.117 WP_000825929.1.11719 WP_000825929.1.11720 WP_000825929.1.11795 WP_000825929.1.11816 WP_000825929.1.11829 WP_000825929.1.11991 WP_000825929.1.12005 WP_000825929.1.1205 WP_000825929.1.12073 WP_000825929.1.12098 WP_000825929.1.12123 WP_000825929.1.12179 WP_000825929.1.12181 WP_000825929.1.12226 WP_000825929.1.12233 WP_000825929.1.12297 WP_000825929.1.12328 WP_000825929.1.12447 WP_000825929.1.12498 WP_000825929.1.1252 WP_000825929.1.12639 WP_000825929.1.12715 WP_000825929.1.12771 WP_000825929.1.12822 WP_000825929.1.12833 WP_000825929.1.12845 WP_000825929.1.12862 WP_000825929.1.12903 WP_000825929.1.12937 WP_000825929.1.12938 WP_000825929.1.13039 WP_000825929.1.13072 WP_000825929.1.13091 WP_000825929.1.13104 WP_000825929.1.13164 WP_000825929.1.13322 WP_000825929.1.13468 WP_000825929.1.1347 WP_000825929.1.13486 WP_000825929.1.13531 WP_000825929.1.1355 WP_000825929.1.13556 WP_000825929.1.13568 WP_000825929.1.13617 WP_000825929.1.13650 WP_000825929.1.13654 WP_000825929.1.13683 WP_000825929.1.13726 WP_000825929.1.13727 WP_000825929.1.1374 WP_000825929.1.13755 WP_000825929.1.13757 WP_000825929.1.13772 WP_000825929.1.13804 WP_000825929.1.13805 WP_000825929.1.13914 WP_000825929.1.13940 WP_000825929.1.13983 WP_000825929.1.14071 WP_000825929.1.14076 WP_000825929.1.14112 WP_000825929.1.14153 WP_000825929.1.14233 WP_000825929.1.1426 WP_000825929.1.14364 WP_000825929.1.14365 WP_000825929.1.14366 WP_000825929.1.14394 WP_000825929.1.14418 WP_000825929.1.14475 WP_000825929.1.1457 WP_000825929.1.14590 WP_000825929.1.1468 WP_000825929.1.147 WP_000825929.1.14744 WP_000825929.1.1477 WP_000825929.1.14790 WP_000825929.1.14809 WP_000825929.1.14869 WP_000825929.1.14888 WP_000825929.1.14902 WP_000825929.1.14924 WP_000825929.1.14987 WP_000825929.1.15000 WP_000825929.1.15091 WP_000825929.1.15228 WP_000825929.1.15241 WP_000825929.1.15255 WP_000825929.1.15263 WP_000825929.1.15278 WP_000825929.1.15329 WP_000825929.1.15389 WP_000825929.1.15399 WP_000825929.1.15403 WP_000825929.1.15409 WP_000825929.1.15438 WP_000825929.1.1545 WP_000825929.1.15478 WP_000825929.1.15489 WP_000825929.1.15505 WP_000825929.1.15524 WP_000825929.1.15572 WP_000825929.1.15601 WP_000825929.1.15687 WP_000825929.1.1569 WP_000825929.1.15706 WP_000825929.1.15753 WP_000825929.1.1579 WP_000825929.1.15818 WP_000825929.1.1583 WP_000825929.1.15838 WP_000825929.1.15883 WP_000825929.1.15892 WP_000825929.1.15897 WP_000825929.1.15898 WP_000825929.1.15928 WP_000825929.1.15957 WP_000825929.1.15972 WP_000825929.1.1600 WP_000825929.1.1606 WP_000825929.1.16112 WP_000825929.1.16213 WP_000825929.1.16237 WP_000825929.1.16362 WP_000825929.1.16417 WP_000825929.1.16455 WP_000825929.1.16467 WP_000825929.1.16554 WP_000825929.1.16569 WP_000825929.1.16603 WP_000825929.1.16617 WP_000825929.1.16628 WP_000825929.1.16672 WP_000825929.1.16679 WP_000825929.1.16688 WP_000825929.1.16703 WP_000825929.1.16757 WP_000825929.1.16768 WP_000825929.1.16770 WP_000825929.1.16776 WP_000825929.1.16892 WP_000825929.1.16946 WP_000825929.1.17038 WP_000825929.1.17050 WP_000825929.1.17104 WP_000825929.1.17137 WP_000825929.1.17169 WP_000825929.1.17210 WP_000825929.1.17231 WP_000825929.1.17234 WP_000825929.1.17249 WP_000825929.1.1725 WP_000825929.1.17256 WP_000825929.1.17289 WP_000825929.1.17320 WP_000825929.1.1740 WP_000825929.1.17450 WP_000825929.1.17485 WP_000825929.1.17520 WP_000825929.1.17581 WP_000825929.1.17650 WP_000825929.1.17657 WP_000825929.1.17666 WP_000825929.1.17676 WP_000825929.1.17729 WP_000825929.1.17770 WP_000825929.1.17834 WP_000825929.1.17845 WP_000825929.1.17859 WP_000825929.1.17876 WP_000825929.1.17929 WP_000825929.1.17951 WP_000825929.1.18016 WP_000825929.1.18035 WP_000825929.1.18074 WP_000825929.1.18105 WP_000825929.1.18197 WP_000825929.1.18283 WP_000825929.1.18290 WP_000825929.1.18320 WP_000825929.1.18346 WP_000825929.1.1835 WP_000825929.1.18437 WP_000825929.1.18451 WP_000825929.1.1851 WP_000825929.1.18516 WP_000825929.1.18529 WP_000825929.1.18538 WP_000825929.1.18562 WP_000825929.1.18567 WP_000825929.1.18611 WP_000825929.1.18627 WP_000825929.1.18658 WP_000825929.1.18668 WP_000825929.1.18758 WP_000825929.1.18809 WP_000825929.1.18830 WP_000825929.1.18836 WP_000825929.1.18879 WP_000825929.1.18918 WP_000825929.1.18938 WP_000825929.1.18968 WP_000825929.1.18987 WP_000825929.1.19009 WP_000825929.1.1901 WP_000825929.1.19022 WP_000825929.1.19027 WP_000825929.1.19149 WP_000825929.1.19179 WP_000825929.1.192 WP_000825929.1.19272 WP_000825929.1.19390 WP_000825929.1.19399 WP_000825929.1.19411 WP_000825929.1.19444 WP_000825929.1.19509 WP_000825929.1.19733 WP_000825929.1.1975 WP_000825929.1.19765 WP_000825929.1.19775 WP_000825929.1.19788 WP_000825929.1.19807 WP_000825929.1.19853 WP_000825929.1.19977 WP_000825929.1.2 WP_000825929.1.20057 WP_000825929.1.2013 WP_000825929.1.20155 WP_000825929.1.20160 WP_000825929.1.20210 WP_000825929.1.20235 WP_000825929.1.20265 WP_000825929.1.20386 WP_000825929.1.20473 WP_000825929.1.20500 WP_000825929.1.20554 WP_000825929.1.20649 WP_000825929.1.20661 WP_000825929.1.20690 WP_000825929.1.20772 WP_000825929.1.20833 WP_000825929.1.20860 WP_000825929.1.20975 WP_000825929.1.21013 WP_000825929.1.21054 WP_000825929.1.21080 WP_000825929.1.21081 WP_000825929.1.2128 WP_000825929.1.2129 WP_000825929.1.21312 WP_000825929.1.21356 WP_000825929.1.21386 WP_000825929.1.21402 WP_000825929.1.21465 WP_000825929.1.2154 WP_000825929.1.21583 WP_000825929.1.21601 WP_000825929.1.21621 WP_000825929.1.21679 WP_000825929.1.21712 WP_000825929.1.21820 WP_000825929.1.21890 WP_000825929.1.21901 WP_000825929.1.22045 WP_000825929.1.22065 WP_000825929.1.22149 WP_000825929.1.22163 WP_000825929.1.22165 WP_000825929.1.22170 WP_000825929.1.22174 WP_000825929.1.22180 WP_000825929.1.22246 WP_000825929.1.22332 WP_000825929.1.22344 WP_000825929.1.22351 WP_000825929.1.22367 WP_000825929.1.22526 WP_000825929.1.22551 WP_000825929.1.22657 WP_000825929.1.22730 WP_000825929.1.22731 WP_000825929.1.2280 WP_000825929.1.22811 WP_000825929.1.22843 WP_000825929.1.22859 WP_000825929.1.22861 WP_000825929.1.22994 WP_000825929.1.23004 WP_000825929.1.23048 WP_000825929.1.23152 WP_000825929.1.23197 WP_000825929.1.23222 WP_000825929.1.23228 WP_000825929.1.23238 WP_000825929.1.23381 WP_000825929.1.23420 WP_000825929.1.23450 WP_000825929.1.23489 WP_000825929.1.23491 WP_000825929.1.23541 WP_000825929.1.23544 WP_000825929.1.23580 WP_000825929.1.23586 WP_000825929.1.23613 WP_000825929.1.23626 WP_000825929.1.2365 WP_000825929.1.23822 WP_000825929.1.23849 WP_000825929.1.23902 WP_000825929.1.23907 WP_000825929.1.23935 WP_000825929.1.23944 WP_000825929.1.23998 WP_000825929.1.24148 WP_000825929.1.24167 WP_000825929.1.2423 WP_000825929.1.24241 WP_000825929.1.24279 WP_000825929.1.2434 WP_000825929.1.24364 WP_000825929.1.24418 WP_000825929.1.2442 WP_000825929.1.24443 WP_000825929.1.24462 WP_000825929.1.24478 WP_000825929.1.24503 WP_000825929.1.24519 WP_000825929.1.2458 WP_000825929.1.24617 WP_000825929.1.24685 WP_000825929.1.24702 WP_000825929.1.24745 WP_000825929.1.24781 WP_000825929.1.2480 WP_000825929.1.24802 WP_000825929.1.24891 WP_000825929.1.25083 WP_000825929.1.25095 WP_000825929.1.25170 WP_000825929.1.25262 WP_000825929.1.25438 WP_000825929.1.25469 WP_000825929.1.25479 WP_000825929.1.25511 WP_000825929.1.25567 WP_000825929.1.25593 WP_000825929.1.25633 WP_000825929.1.25634 WP_000825929.1.25737 WP_000825929.1.25770 WP_000825929.1.2579 WP_000825929.1.25801 WP_000825929.1.25820 WP_000825929.1.25867 WP_000825929.1.25868 WP_000825929.1.25881 WP_000825929.1.25891 WP_000825929.1.2593 WP_000825929.1.26006 WP_000825929.1.26015 WP_000825929.1.262 WP_000825929.1.26293 WP_000825929.1.26307 WP_000825929.1.26346 WP_000825929.1.26370 WP_000825929.1.26405 WP_000825929.1.26481 WP_000825929.1.2656 WP_000825929.1.2658 WP_000825929.1.2661 WP_000825929.1.26626 WP_000825929.1.2664 WP_000825929.1.26663 WP_000825929.1.26733 WP_000825929.1.2674 WP_000825929.1.26771 WP_000825929.1.26790 WP_000825929.1.26927 WP_000825929.1.26958 WP_000825929.1.27042 WP_000825929.1.27154 WP_000825929.1.2718 WP_000825929.1.27207 WP_000825929.1.27246 WP_000825929.1.27311 WP_000825929.1.27333 WP_000825929.1.2734 WP_000825929.1.27345 WP_000825929.1.27448 WP_000825929.1.27455 WP_000825929.1.27457 WP_000825929.1.27551 WP_000825929.1.27562 WP_000825929.1.2759 WP_000825929.1.27608 WP_000825929.1.27614 WP_000825929.1.27615 WP_000825929.1.27621 WP_000825929.1.27640 WP_000825929.1.27654 WP_000825929.1.27670 WP_000825929.1.2768 WP_000825929.1.27717 WP_000825929.1.27748 WP_000825929.1.27817 WP_000825929.1.27854 WP_000825929.1.27950 WP_000825929.1.27953 WP_000825929.1.27972 WP_000825929.1.28007 WP_000825929.1.28025 WP_000825929.1.28063 WP_000825929.1.28071 WP_000825929.1.28088 WP_000825929.1.28117 WP_000825929.1.28138 WP_000825929.1.28147 WP_000825929.1.28158 WP_000825929.1.28191 WP_000825929.1.28207 WP_000825929.1.28358 WP_000825929.1.28360 WP_000825929.1.28376 WP_000825929.1.28381 WP_000825929.1.28477 WP_000825929.1.28498 WP_000825929.1.28502 WP_000825929.1.28527 WP_000825929.1.28532 WP_000825929.1.28629 WP_000825929.1.28650 WP_000825929.1.28675 WP_000825929.1.28710 WP_000825929.1.28725 WP_000825929.1.28862 WP_000825929.1.28866 WP_000825929.1.28887 WP_000825929.1.28915 WP_000825929.1.28933 WP_000825929.1.28960 WP_000825929.1.28970 WP_000825929.1.29090 WP_000825929.1.29107 WP_000825929.1.29188 WP_000825929.1.29207 WP_000825929.1.29272 WP_000825929.1.29282 WP_000825929.1.29285 WP_000825929.1.29312 WP_000825929.1.29315 WP_000825929.1.29372 WP_000825929.1.29373 WP_000825929.1.29381 WP_000825929.1.29511 WP_000825929.1.29541 WP_000825929.1.29554 WP_000825929.1.29561 WP_000825929.1.29596 WP_000825929.1.29644 WP_000825929.1.29676 WP_000825929.1.29716 WP_000825929.1.2975 WP_000825929.1.29758 WP_000825929.1.29781 WP_000825929.1.29805 WP_000825929.1.29826 WP_000825929.1.29885 WP_000825929.1.29963 WP_000825929.1.30012 WP_000825929.1.30023 WP_000825929.1.30033 WP_000825929.1.30047 WP_000825929.1.30057 WP_000825929.1.30154 WP_000825929.1.30176 WP_000825929.1.30186 WP_000825929.1.30274 WP_000825929.1.30333 WP_000825929.1.30350 WP_000825929.1.30367 WP_000825929.1.30376 WP_000825929.1.30381 WP_000825929.1.30418 WP_000825929.1.30422 WP_000825929.1.30477 WP_000825929.1.30496 WP_000825929.1.30530 WP_000825929.1.30623 WP_000825929.1.30758 WP_000825929.1.30779 WP_000825929.1.30862 WP_000825929.1.30863 WP_000825929.1.30874 WP_000825929.1.30878 WP_000825929.1.30889 WP_000825929.1.30911 WP_000825929.1.30916 WP_000825929.1.3097 WP_000825929.1.30970 WP_000825929.1.30971 WP_000825929.1.30998 WP_000825929.1.31037 WP_000825929.1.31068 WP_000825929.1.31124 WP_000825929.1.31194 WP_000825929.1.31204 WP_000825929.1.31212 WP_000825929.1.31232 WP_000825929.1.3132 WP_000825929.1.31376 WP_000825929.1.31426 WP_000825929.1.31436 WP_000825929.1.31462 WP_000825929.1.31478 WP_000825929.1.315 WP_000825929.1.31505 WP_000825929.1.31567 WP_000825929.1.31611 WP_000825929.1.31621 WP_000825929.1.31638 WP_000825929.1.31667 WP_000825929.1.31787 WP_000825929.1.31797 WP_000825929.1.31817 WP_000825929.1.31897 WP_000825929.1.31925 WP_000825929.1.31949 WP_000825929.1.31990 WP_000825929.1.31994 WP_000825929.1.32040 WP_000825929.1.32059 WP_000825929.1.32118 WP_000825929.1.32122 WP_000825929.1.32125 WP_000825929.1.32130 WP_000825929.1.32167 WP_000825929.1.32217 WP_000825929.1.32244 WP_000825929.1.32248 WP_000825929.1.32281 WP_000825929.1.32295 WP_000825929.1.32365 WP_000825929.1.32384 WP_000825929.1.32405 WP_000825929.1.3244 WP_000825929.1.32454 WP_000825929.1.32464 WP_000825929.1.32555 WP_000825929.1.32739 WP_000825929.1.32839 WP_000825929.1.32921 WP_000825929.1.32987 WP_000825929.1.3299 WP_000825929.1.3306 WP_000825929.1.33108 WP_000825929.1.33147 WP_000825929.1.33172 WP_000825929.1.33213 WP_000825929.1.33252 WP_000825929.1.33255 WP_000825929.1.33292 WP_000825929.1.33307 WP_000825929.1.3335 WP_000825929.1.33350 WP_000825929.1.33372 WP_000825929.1.3338 WP_000825929.1.33388 WP_000825929.1.33394 WP_000825929.1.3341 WP_000825929.1.33426 WP_000825929.1.3345 WP_000825929.1.33463 WP_000825929.1.33483 WP_000825929.1.33484 WP_000825929.1.33520 WP_000825929.1.33575 WP_000825929.1.33640 WP_000825929.1.33650 WP_000825929.1.33724 WP_000825929.1.33737 WP_000825929.1.33756 WP_000825929.1.33765 WP_000825929.1.33766 WP_000825929.1.33778 WP_000825929.1.33816 WP_000825929.1.33899 WP_000825929.1.33949 WP_000825929.1.33963 WP_000825929.1.33966 WP_000825929.1.33994 WP_000825929.1.34069 WP_000825929.1.34080 WP_000825929.1.34105 WP_000825929.1.34112 WP_000825929.1.34128 WP_000825929.1.3418 WP_000825929.1.34194 WP_000825929.1.34223 WP_000825929.1.34280 WP_000825929.1.34334 WP_000825929.1.34361 WP_000825929.1.3442 WP_000825929.1.34471 WP_000825929.1.3448 WP_000825929.1.34512 WP_000825929.1.34569 WP_000825929.1.34716 WP_000825929.1.34723 WP_000825929.1.3474 WP_000825929.1.34741 WP_000825929.1.34847 WP_000825929.1.34865 WP_000825929.1.34923 WP_000825929.1.34926 WP_000825929.1.34967 WP_000825929.1.35014 WP_000825929.1.35031 WP_000825929.1.35032 WP_000825929.1.35289 WP_000825929.1.35307 WP_000825929.1.35314 WP_000825929.1.35340 WP_000825929.1.35391 WP_000825929.1.35413 WP_000825929.1.3542 WP_000825929.1.35508 WP_000825929.1.35517 WP_000825929.1.35519 WP_000825929.1.35549 WP_000825929.1.35642 WP_000825929.1.35659 WP_000825929.1.35661 WP_000825929.1.35686 WP_000825929.1.35696 WP_000825929.1.35784 WP_000825929.1.3579 WP_000825929.1.35837 WP_000825929.1.35888 WP_000825929.1.35890 WP_000825929.1.35903 WP_000825929.1.36093 WP_000825929.1.36179 WP_000825929.1.36208 WP_000825929.1.36249 WP_000825929.1.36302 WP_000825929.1.36430 WP_000825929.1.36434 WP_000825929.1.36439 WP_000825929.1.36640 WP_000825929.1.36669 WP_000825929.1.36704 WP_000825929.1.36729 WP_000825929.1.36773 WP_000825929.1.36814 WP_000825929.1.36847 WP_000825929.1.36888 WP_000825929.1.36903 WP_000825929.1.36911 WP_000825929.1.36932 WP_000825929.1.37075 WP_000825929.1.3709 WP_000825929.1.37120 WP_000825929.1.37130 WP_000825929.1.37145 WP_000825929.1.37159 WP_000825929.1.3722 WP_000825929.1.37240 WP_000825929.1.37335 WP_000825929.1.37378 WP_000825929.1.37411 WP_000825929.1.37435 WP_000825929.1.37503 WP_000825929.1.37546 WP_000825929.1.37644 WP_000825929.1.37669 WP_000825929.1.37679 WP_000825929.1.3774 WP_000825929.1.37749 WP_000825929.1.37764 WP_000825929.1.37771 WP_000825929.1.37788 WP_000825929.1.37851 WP_000825929.1.37906 WP_000825929.1.37907 WP_000825929.1.37929 WP_000825929.1.38030 WP_000825929.1.38100 WP_000825929.1.38111 WP_000825929.1.38128 WP_000825929.1.38136 WP_000825929.1.38222 WP_000825929.1.38304 WP_000825929.1.38316 WP_000825929.1.38390 WP_000825929.1.38422 WP_000825929.1.38435 WP_000825929.1.38516 WP_000825929.1.38555 WP_000825929.1.38688 WP_000825929.1.3875 WP_000825929.1.38862 WP_000825929.1.38875 WP_000825929.1.38885 WP_000825929.1.38890 WP_000825929.1.38927 WP_000825929.1.38960 WP_000825929.1.39017 WP_000825929.1.39026 WP_000825929.1.39126 WP_000825929.1.39166 WP_000825929.1.39173 WP_000825929.1.39324 WP_000825929.1.39330 WP_000825929.1.39361 WP_000825929.1.39384 WP_000825929.1.39432 WP_000825929.1.39451 WP_000825929.1.39494 WP_000825929.1.39499 WP_000825929.1.39527 WP_000825929.1.39542 WP_000825929.1.39642 WP_000825929.1.39670 WP_000825929.1.39671 WP_000825929.1.39682 WP_000825929.1.39693 WP_000825929.1.39857 WP_000825929.1.39943 WP_000825929.1.39995 WP_000825929.1.40076 WP_000825929.1.40082 WP_000825929.1.4010 WP_000825929.1.40149 WP_000825929.1.40247 WP_000825929.1.40329 WP_000825929.1.40340 WP_000825929.1.40369 WP_000825929.1.40409 WP_000825929.1.40428 WP_000825929.1.40472 WP_000825929.1.40483 WP_000825929.1.40500 WP_000825929.1.40613 WP_000825929.1.40670 WP_000825929.1.40700 WP_000825929.1.40719 WP_000825929.1.40729 WP_000825929.1.4078 WP_000825929.1.40780 WP_000825929.1.40814 WP_000825929.1.40939 WP_000825929.1.40997 WP_000825929.1.41033 WP_000825929.1.41038 WP_000825929.1.4105 WP_000825929.1.412 WP_000825929.1.41350 WP_000825929.1.41374 WP_000825929.1.41386 WP_000825929.1.41458 WP_000825929.1.41511 WP_000825929.1.41555 WP_000825929.1.41581 WP_000825929.1.41587 WP_000825929.1.41598 WP_000825929.1.41612 WP_000825929.1.41620 WP_000825929.1.41647 WP_000825929.1.41681 WP_000825929.1.4169 WP_000825929.1.41743 WP_000825929.1.41755 WP_000825929.1.41796 WP_000825929.1.4182 WP_000825929.1.41863 WP_000825929.1.41972 WP_000825929.1.41983 WP_000825929.1.42003 WP_000825929.1.4202 WP_000825929.1.42056 WP_000825929.1.42072 WP_000825929.1.42085 WP_000825929.1.42169 WP_000825929.1.42178 WP_000825929.1.42230 WP_000825929.1.42241 WP_000825929.1.4225 WP_000825929.1.42286 WP_000825929.1.42298 WP_000825929.1.42325 WP_000825929.1.42344 WP_000825929.1.42607 WP_000825929.1.42679 WP_000825929.1.42681 WP_000825929.1.42733 WP_000825929.1.42764 WP_000825929.1.42788 WP_000825929.1.42798 WP_000825929.1.42816 WP_000825929.1.42907 WP_000825929.1.42925 WP_000825929.1.42959 WP_000825929.1.42984 WP_000825929.1.42985 WP_000825929.1.42990 WP_000825929.1.43023 WP_000825929.1.43061 WP_000825929.1.43095 WP_000825929.1.43110 WP_000825929.1.43125 WP_000825929.1.43139 WP_000825929.1.43168 WP_000825929.1.43179 WP_000825929.1.43204 WP_000825929.1.43252 WP_000825929.1.43279 WP_000825929.1.43360 WP_000825929.1.43375 WP_000825929.1.43405 WP_000825929.1.43410 WP_000825929.1.43446 WP_000825929.1.43512 WP_000825929.1.43530 WP_000825929.1.43665 WP_000825929.1.43693 WP_000825929.1.43784 WP_000825929.1.4386 WP_000825929.1.43964 WP_000825929.1.43984 WP_000825929.1.43995 WP_000825929.1.44074 WP_000825929.1.44095 WP_000825929.1.44177 WP_000825929.1.44178 WP_000825929.1.44344 WP_000825929.1.44382 WP_000825929.1.44432 WP_000825929.1.44504 WP_000825929.1.44515 WP_000825929.1.44517 WP_000825929.1.44520 WP_000825929.1.44586 WP_000825929.1.44623 WP_000825929.1.44655 WP_000825929.1.44667 WP_000825929.1.447 WP_000825929.1.44714 WP_000825929.1.44715 WP_000825929.1.44856 WP_000825929.1.44868 WP_000825929.1.44876 WP_000825929.1.44892 WP_000825929.1.44899 WP_000825929.1.44940 WP_000825929.1.44993 WP_000825929.1.45042 WP_000825929.1.45050 WP_000825929.1.45080 WP_000825929.1.45091 WP_000825929.1.45094 WP_000825929.1.45140 WP_000825929.1.45157 WP_000825929.1.45162 WP_000825929.1.452 WP_000825929.1.45223 WP_000825929.1.45242 WP_000825929.1.45267 WP_000825929.1.4527 WP_000825929.1.45281 WP_000825929.1.4545 WP_000825929.1.45450 WP_000825929.1.45456 WP_000825929.1.4546 WP_000825929.1.45542 WP_000825929.1.45555 WP_000825929.1.45574 WP_000825929.1.45610 WP_000825929.1.45645 WP_000825929.1.45654 WP_000825929.1.45698 WP_000825929.1.45705 WP_000825929.1.45763 WP_000825929.1.4577 WP_000825929.1.45773 WP_000825929.1.4582 WP_000825929.1.45833 WP_000825929.1.45859 WP_000825929.1.45862 WP_000825929.1.45874 WP_000825929.1.4597 WP_000825929.1.45972 WP_000825929.1.45977 WP_000825929.1.45979 WP_000825929.1.46021 WP_000825929.1.46035 WP_000825929.1.46037 WP_000825929.1.46050 WP_000825929.1.46062 WP_000825929.1.46078 WP_000825929.1.46171 WP_000825929.1.46172 WP_000825929.1.46185 WP_000825929.1.46195 WP_000825929.1.46248 WP_000825929.1.46259 WP_000825929.1.46289 WP_000825929.1.46333 WP_000825929.1.46339 WP_000825929.1.46353 WP_000825929.1.46389 WP_000825929.1.46514 WP_000825929.1.46529 WP_000825929.1.46619 WP_000825929.1.46648 WP_000825929.1.46676 WP_000825929.1.46720 WP_000825929.1.46736 WP_000825929.1.46770 WP_000825929.1.4680 WP_000825929.1.46815 WP_000825929.1.46906 WP_000825929.1.46914 WP_000825929.1.46929 WP_000825929.1.4694 WP_000825929.1.46947 WP_000825929.1.47002 WP_000825929.1.47065 WP_000825929.1.47105 WP_000825929.1.47107 WP_000825929.1.47111 WP_000825929.1.47193 WP_000825929.1.47282 WP_000825929.1.47331 WP_000825929.1.47334 WP_000825929.1.47408 WP_000825929.1.47459 WP_000825929.1.47493 WP_000825929.1.47522 WP_000825929.1.47541 WP_000825929.1.47617 WP_000825929.1.47629 WP_000825929.1.47669 WP_000825929.1.47680 WP_000825929.1.47702 WP_000825929.1.47747 WP_000825929.1.47851 WP_000825929.1.47864 WP_000825929.1.47908 WP_000825929.1.4792 WP_000825929.1.48046 WP_000825929.1.48057 WP_000825929.1.48064 WP_000825929.1.48067 WP_000825929.1.48116 WP_000825929.1.48142 WP_000825929.1.48156 WP_000825929.1.48187 WP_000825929.1.48223 WP_000825929.1.48272 WP_000825929.1.48282 WP_000825929.1.48310 WP_000825929.1.48335 WP_000825929.1.48338 WP_000825929.1.48376 WP_000825929.1.48398 WP_000825929.1.4840 WP_000825929.1.48427 WP_000825929.1.48437 WP_000825929.1.48438 WP_000825929.1.48479 WP_000825929.1.4852 WP_000825929.1.48580 WP_000825929.1.48664 WP_000825929.1.48670 WP_000825929.1.48723 WP_000825929.1.48769 WP_000825929.1.48782 WP_000825929.1.48817 WP_000825929.1.48869 WP_000825929.1.49018 WP_000825929.1.49032 WP_000825929.1.49071 WP_000825929.1.49094 WP_000825929.1.49105 WP_000825929.1.49171 WP_000825929.1.49196 WP_000825929.1.49199 WP_000825929.1.4924 WP_000825929.1.49257 WP_000825929.1.49301 WP_000825929.1.49362 WP_000825929.1.49418 WP_000825929.1.49444 WP_000825929.1.4945 WP_000825929.1.49479 WP_000825929.1.49518 WP_000825929.1.49539 WP_000825929.1.49549 WP_000825929.1.49582 WP_000825929.1.496 WP_000825929.1.49603 WP_000825929.1.49643 WP_000825929.1.49672 WP_000825929.1.49690 WP_000825929.1.49728 WP_000825929.1.49732 WP_000825929.1.49745 WP_000825929.1.49819 WP_000825929.1.4982 WP_000825929.1.49918 WP_000825929.1.49935 WP_000825929.1.50028 WP_000825929.1.50117 WP_000825929.1.50145 WP_000825929.1.50178 WP_000825929.1.50192 WP_000825929.1.50291 WP_000825929.1.50367 WP_000825929.1.50369 WP_000825929.1.50388 WP_000825929.1.5045 WP_000825929.1.50464 WP_000825929.1.50477 WP_000825929.1.50525 WP_000825929.1.50556 WP_000825929.1.50558 WP_000825929.1.5059 WP_000825929.1.50594 WP_000825929.1.50647 WP_000825929.1.50699 WP_000825929.1.50740 WP_000825929.1.50817 WP_000825929.1.50829 WP_000825929.1.50974 WP_000825929.1.51015 WP_000825929.1.51130 WP_000825929.1.51209 WP_000825929.1.51220 WP_000825929.1.51226 WP_000825929.1.51271 WP_000825929.1.51277 WP_000825929.1.51326 WP_000825929.1.51365 WP_000825929.1.51393 WP_000825929.1.51496 WP_000825929.1.51557 WP_000825929.1.51741 WP_000825929.1.51794 WP_000825929.1.51824 WP_000825929.1.5186 WP_000825929.1.52034 WP_000825929.1.52061 WP_000825929.1.52072 WP_000825929.1.52195 WP_000825929.1.52198 WP_000825929.1.52210 WP_000825929.1.52289 WP_000825929.1.52308 WP_000825929.1.5231 WP_000825929.1.52343 WP_000825929.1.52377 WP_000825929.1.52396 WP_000825929.1.52427 WP_000825929.1.52452 WP_000825929.1.5251 WP_000825929.1.52511 WP_000825929.1.52605 WP_000825929.1.52830 WP_000825929.1.52889 WP_000825929.1.52900 WP_000825929.1.52965 WP_000825929.1.52983 WP_000825929.1.5304 WP_000825929.1.53050 WP_000825929.1.53057 WP_000825929.1.5319 WP_000825929.1.53245 WP_000825929.1.53285 WP_000825929.1.53312 WP_000825929.1.53323 WP_000825929.1.53363 WP_000825929.1.53372 WP_000825929.1.53373 WP_000825929.1.53379 WP_000825929.1.53408 WP_000825929.1.53418 WP_000825929.1.53452 WP_000825929.1.53467 WP_000825929.1.5347 WP_000825929.1.53532 WP_000825929.1.53759 WP_000825929.1.53774 WP_000825929.1.53799 WP_000825929.1.53911 WP_000825929.1.53926 WP_000825929.1.54049 WP_000825929.1.54074 WP_000825929.1.54086 WP_000825929.1.54094 WP_000825929.1.54237 WP_000825929.1.54290 WP_000825929.1.54299 WP_000825929.1.54404 WP_000825929.1.54438 WP_000825929.1.54446 WP_000825929.1.54471 WP_000825929.1.54479 WP_000825929.1.54485 WP_000825929.1.54543 WP_000825929.1.54554 WP_000825929.1.54574 WP_000825929.1.54744 WP_000825929.1.54830 WP_000825929.1.54851 WP_000825929.1.54929 WP_000825929.1.54931 WP_000825929.1.54967 WP_000825929.1.54990 WP_000825929.1.5500 WP_000825929.1.55004 WP_000825929.1.55082 WP_000825929.1.55084 WP_000825929.1.55095 WP_000825929.1.55139 WP_000825929.1.5518 WP_000825929.1.552 WP_000825929.1.55239 WP_000825929.1.55271 WP_000825929.1.55272 WP_000825929.1.55327 WP_000825929.1.55336 WP_000825929.1.55419 WP_000825929.1.55495 WP_000825929.1.5550 WP_000825929.1.55527 WP_000825929.1.55535 WP_000825929.1.55603 WP_000825929.1.5562 WP_000825929.1.55717 WP_000825929.1.55719 WP_000825929.1.55724 WP_000825929.1.55784 WP_000825929.1.55845 WP_000825929.1.55949 WP_000825929.1.55955 WP_000825929.1.55985 WP_000825929.1.56003 WP_000825929.1.5604 WP_000825929.1.56064 WP_000825929.1.56106 WP_000825929.1.56135 WP_000825929.1.56159 WP_000825929.1.56200 WP_000825929.1.56220 WP_000825929.1.56237 WP_000825929.1.56265 WP_000825929.1.56387 WP_000825929.1.56464 WP_000825929.1.56482 WP_000825929.1.56527 WP_000825929.1.56542 WP_000825929.1.56584 WP_000825929.1.56608 WP_000825929.1.56619 WP_000825929.1.56702 WP_000825929.1.56708 WP_000825929.1.56737 WP_000825929.1.5675 WP_000825929.1.56779 WP_000825929.1.56822 WP_000825929.1.56903 WP_000825929.1.56931 WP_000825929.1.56966 WP_000825929.1.56975 WP_000825929.1.57015 WP_000825929.1.5705 WP_000825929.1.57080 WP_000825929.1.57081 WP_000825929.1.57115 WP_000825929.1.57141 WP_000825929.1.57196 WP_000825929.1.57330 WP_000825929.1.57338 WP_000825929.1.57427 WP_000825929.1.57448 WP_000825929.1.5749 WP_000825929.1.57593 WP_000825929.1.57670 WP_000825929.1.57693 WP_000825929.1.57701 WP_000825929.1.57718 WP_000825929.1.57723 WP_000825929.1.57727 WP_000825929.1.57745 WP_000825929.1.57783 WP_000825929.1.57844 WP_000825929.1.57962 WP_000825929.1.5799 WP_000825929.1.58006 WP_000825929.1.58035 WP_000825929.1.58051 WP_000825929.1.58122 WP_000825929.1.5817 WP_000825929.1.58185 WP_000825929.1.58198 WP_000825929.1.58241 WP_000825929.1.58246 WP_000825929.1.58325 WP_000825929.1.58350 WP_000825929.1.58353 WP_000825929.1.58366 WP_000825929.1.58373 WP_000825929.1.58392 WP_000825929.1.58419 WP_000825929.1.58421 WP_000825929.1.58481 WP_000825929.1.5849 WP_000825929.1.58508 WP_000825929.1.58521 WP_000825929.1.58538 WP_000825929.1.586 WP_000825929.1.58603 WP_000825929.1.58686 WP_000825929.1.58714 WP_000825929.1.58775 WP_000825929.1.58936 WP_000825929.1.58998 WP_000825929.1.5901 WP_000825929.1.5904 WP_000825929.1.59133 WP_000825929.1.59187 WP_000825929.1.5925 WP_000825929.1.59269 WP_000825929.1.59284 WP_000825929.1.59327 WP_000825929.1.59329 WP_000825929.1.59337 WP_000825929.1.59363 WP_000825929.1.59397 WP_000825929.1.59457 WP_000825929.1.59459 WP_000825929.1.59467 WP_000825929.1.59478 WP_000825929.1.59603 WP_000825929.1.59609 WP_000825929.1.59624 WP_000825929.1.59629 WP_000825929.1.59643 WP_000825929.1.59663 WP_000825929.1.59697 WP_000825929.1.59803 WP_000825929.1.59881 WP_000825929.1.59886 WP_000825929.1.59945 WP_000825929.1.59977 WP_000825929.1.60022 WP_000825929.1.60086 WP_000825929.1.60156 WP_000825929.1.60181 WP_000825929.1.60201 WP_000825929.1.60251 WP_000825929.1.60259 WP_000825929.1.60280 WP_000825929.1.60307 WP_000825929.1.60368 WP_000825929.1.60462 WP_000825929.1.60515 WP_000825929.1.60551 WP_000825929.1.60594 WP_000825929.1.60690 WP_000825929.1.60696 WP_000825929.1.60787 WP_000825929.1.60898 WP_000825929.1.60939 WP_000825929.1.60946 WP_000825929.1.60981 WP_000825929.1.61009 WP_000825929.1.61030 WP_000825929.1.61119 WP_000825929.1.61152 WP_000825929.1.61153 WP_000825929.1.6118 WP_000825929.1.61188 WP_000825929.1.61224 WP_000825929.1.61257 WP_000825929.1.61324 WP_000825929.1.61339 WP_000825929.1.61394 WP_000825929.1.61408 WP_000825929.1.61413 WP_000825929.1.61421 WP_000825929.1.61547 WP_000825929.1.61591 WP_000825929.1.6168 WP_000825929.1.61784 WP_000825929.1.61897 WP_000825929.1.61910 WP_000825929.1.61970 WP_000825929.1.62030 WP_000825929.1.62088 WP_000825929.1.62093 WP_000825929.1.62140 WP_000825929.1.62164 WP_000825929.1.62367 WP_000825929.1.62409 WP_000825929.1.62437 WP_000825929.1.62459 WP_000825929.1.62537 WP_000825929.1.62539 WP_000825929.1.62575 WP_000825929.1.62625 WP_000825929.1.62685 WP_000825929.1.62740 WP_000825929.1.62756 WP_000825929.1.62781 WP_000825929.1.62796 WP_000825929.1.62808 WP_000825929.1.62829 WP_000825929.1.62842 WP_000825929.1.62878 WP_000825929.1.62956 WP_000825929.1.63004 WP_000825929.1.63011 WP_000825929.1.63050 WP_000825929.1.631 WP_000825929.1.63132 WP_000825929.1.63182 WP_000825929.1.63195 WP_000825929.1.63233 WP_000825929.1.63273 WP_000825929.1.63279 WP_000825929.1.63296 WP_000825929.1.63307 WP_000825929.1.63319 WP_000825929.1.63322 WP_000825929.1.63324 WP_000825929.1.63335 WP_000825929.1.63337 WP_000825929.1.63383 WP_000825929.1.634 WP_000825929.1.63406 WP_000825929.1.63411 WP_000825929.1.63421 WP_000825929.1.63460 WP_000825929.1.63510 WP_000825929.1.63527 WP_000825929.1.63565 WP_000825929.1.63617 WP_000825929.1.63693 WP_000825929.1.63705 WP_000825929.1.6378 WP_000825929.1.63847 WP_000825929.1.63894 WP_000825929.1.63975 WP_000825929.1.64012 WP_000825929.1.64094 WP_000825929.1.64108 WP_000825929.1.64207 WP_000825929.1.64251 WP_000825929.1.64303 WP_000825929.1.64304 WP_000825929.1.64368 WP_000825929.1.64400 WP_000825929.1.64440 WP_000825929.1.64598 WP_000825929.1.64628 WP_000825929.1.64630 WP_000825929.1.64631 WP_000825929.1.64643 WP_000825929.1.64665 WP_000825929.1.64811 WP_000825929.1.64845 WP_000825929.1.64860 WP_000825929.1.64951 WP_000825929.1.64956 WP_000825929.1.64994 WP_000825929.1.64996 WP_000825929.1.64998 WP_000825929.1.65025 WP_000825929.1.65033 WP_000825929.1.65038 WP_000825929.1.65046 WP_000825929.1.65076 WP_000825929.1.65233 WP_000825929.1.65264 WP_000825929.1.65358 WP_000825929.1.65387 WP_000825929.1.65406 WP_000825929.1.65407 WP_000825929.1.6544 WP_000825929.1.65448 WP_000825929.1.65585 WP_000825929.1.65600 WP_000825929.1.65616 WP_000825929.1.65629 WP_000825929.1.65643 WP_000825929.1.65656 WP_000825929.1.6568 WP_000825929.1.65713 WP_000825929.1.65734 WP_000825929.1.65769 WP_000825929.1.65809 WP_000825929.1.6585 WP_000825929.1.65892 WP_000825929.1.65935 WP_000825929.1.65947 WP_000825929.1.65948 WP_000825929.1.65965 WP_000825929.1.6603 WP_000825929.1.66054 WP_000825929.1.66069 WP_000825929.1.66073 WP_000825929.1.6612 WP_000825929.1.66130 WP_000825929.1.66144 WP_000825929.1.66265 WP_000825929.1.66298 WP_000825929.1.6632 WP_000825929.1.66366 WP_000825929.1.66453 WP_000825929.1.66513 WP_000825929.1.66556 WP_000825929.1.66598 WP_000825929.1.66611 WP_000825929.1.66614 WP_000825929.1.66705 WP_000825929.1.66756 WP_000825929.1.66766 WP_000825929.1.66803 WP_000825929.1.66816 WP_000825929.1.6688 WP_000825929.1.66938 WP_000825929.1.66969 WP_000825929.1.6700 WP_000825929.1.67012 WP_000825929.1.67014 WP_000825929.1.67067 WP_000825929.1.67072 WP_000825929.1.67113 WP_000825929.1.67155 WP_000825929.1.67160 WP_000825929.1.67238 WP_000825929.1.67251 WP_000825929.1.67259 WP_000825929.1.6726 WP_000825929.1.67286 WP_000825929.1.67294 WP_000825929.1.67312 WP_000825929.1.67328 WP_000825929.1.67418 WP_000825929.1.67420 WP_000825929.1.67425 WP_000825929.1.67447 WP_000825929.1.67457 WP_000825929.1.67460 WP_000825929.1.67540 WP_000825929.1.67571 WP_000825929.1.67621 WP_000825929.1.67644 WP_000825929.1.67653 WP_000825929.1.67691 WP_000825929.1.67806 WP_000825929.1.67834 WP_000825929.1.67867 WP_000825929.1.67880 WP_000825929.1.67900 WP_000825929.1.67991 WP_000825929.1.68101 WP_000825929.1.68134 WP_000825929.1.68139 WP_000825929.1.68141 WP_000825929.1.68152 WP_000825929.1.68202 WP_000825929.1.68221 WP_000825929.1.68223 WP_000825929.1.6824 WP_000825929.1.68268 WP_000825929.1.68355 WP_000825929.1.68366 WP_000825929.1.68398 WP_000825929.1.68399 WP_000825929.1.68476 WP_000825929.1.68479 WP_000825929.1.68504 WP_000825929.1.68512 WP_000825929.1.68548 WP_000825929.1.686 WP_000825929.1.68681 WP_000825929.1.68683 WP_000825929.1.68741 WP_000825929.1.68743 WP_000825929.1.68883 WP_000825929.1.68998 WP_000825929.1.69012 WP_000825929.1.69071 WP_000825929.1.69078 WP_000825929.1.69105 WP_000825929.1.69147 WP_000825929.1.6915 WP_000825929.1.69179 WP_000825929.1.69198 WP_000825929.1.69213 WP_000825929.1.69239 WP_000825929.1.69251 WP_000825929.1.69349 WP_000825929.1.69394 WP_000825929.1.69437 WP_000825929.1.69475 WP_000825929.1.69490 WP_000825929.1.69546 WP_000825929.1.69598 WP_000825929.1.6968 WP_000825929.1.69683 WP_000825929.1.69724 WP_000825929.1.69734 WP_000825929.1.6980 WP_000825929.1.69820 WP_000825929.1.69823 WP_000825929.1.69830 WP_000825929.1.69842 WP_000825929.1.69882 WP_000825929.1.699 WP_000825929.1.69902 WP_000825929.1.69934 WP_000825929.1.69980 WP_000825929.1.69995 WP_000825929.1.70059 WP_000825929.1.70161 WP_000825929.1.70220 WP_000825929.1.70225 WP_000825929.1.70228 WP_000825929.1.70294 WP_000825929.1.703 WP_000825929.1.70311 WP_000825929.1.70313 WP_000825929.1.70334 WP_000825929.1.70353 WP_000825929.1.70448 WP_000825929.1.7046 WP_000825929.1.70487 WP_000825929.1.70495 WP_000825929.1.70527 WP_000825929.1.70554 WP_000825929.1.70558 WP_000825929.1.70564 WP_000825929.1.7064 WP_000825929.1.70664 WP_000825929.1.707 WP_000825929.1.70721 WP_000825929.1.70763 WP_000825929.1.70808 WP_000825929.1.70829 WP_000825929.1.70835 WP_000825929.1.70843 WP_000825929.1.70909 WP_000825929.1.70926 WP_000825929.1.70939 WP_000825929.1.710 WP_000825929.1.71016 WP_000825929.1.7105 WP_000825929.1.71143 WP_000825929.1.71182 WP_000825929.1.71208 WP_000825929.1.71231 WP_000825929.1.71267 WP_000825929.1.71313 WP_000825929.1.71410 WP_000825929.1.71416 WP_000825929.1.71419 WP_000825929.1.71466 WP_000825929.1.71467 WP_000825929.1.71475 WP_000825929.1.7158 WP_000825929.1.71590 WP_000825929.1.71715 WP_000825929.1.71721 WP_000825929.1.71737 WP_000825929.1.71741 WP_000825929.1.71780 WP_000825929.1.71863 WP_000825929.1.71877 WP_000825929.1.71892 WP_000825929.1.71899 WP_000825929.1.71910 WP_000825929.1.71978 WP_000825929.1.72002 WP_000825929.1.72018 WP_000825929.1.72085 WP_000825929.1.72148 WP_000825929.1.722 WP_000825929.1.72204 WP_000825929.1.72306 WP_000825929.1.72340 WP_000825929.1.72363 WP_000825929.1.72371 WP_000825929.1.72453 WP_000825929.1.72465 WP_000825929.1.72478 WP_000825929.1.72497 WP_000825929.1.7254 WP_000825929.1.7258 WP_000825929.1.7260 WP_000825929.1.72626 WP_000825929.1.72649 WP_000825929.1.72666 WP_000825929.1.72708 WP_000825929.1.72719 WP_000825929.1.72750 WP_000825929.1.72753 WP_000825929.1.72762 WP_000825929.1.72816 WP_000825929.1.72881 WP_000825929.1.72930 WP_000825929.1.72961 WP_000825929.1.72991 WP_000825929.1.73002 WP_000825929.1.73021 WP_000825929.1.73087 WP_000825929.1.73140 WP_000825929.1.73190 WP_000825929.1.73195 WP_000825929.1.73201 WP_000825929.1.73211 WP_000825929.1.73240 WP_000825929.1.73241 WP_000825929.1.73264 WP_000825929.1.73401 WP_000825929.1.73420 WP_000825929.1.73444 WP_000825929.1.73450 WP_000825929.1.73464 WP_000825929.1.73513 WP_000825929.1.73539 WP_000825929.1.7360 WP_000825929.1.73610 WP_000825929.1.7365 WP_000825929.1.73674 WP_000825929.1.73694 WP_000825929.1.73740 WP_000825929.1.73789 WP_000825929.1.73868 WP_000825929.1.73885 WP_000825929.1.73900 WP_000825929.1.73921 WP_000825929.1.73940 WP_000825929.1.73949 WP_000825929.1.73971 WP_000825929.1.74004 WP_000825929.1.7401 WP_000825929.1.7406 WP_000825929.1.74073 WP_000825929.1.74085 WP_000825929.1.74155 WP_000825929.1.74257 WP_000825929.1.74273 WP_000825929.1.74284 WP_000825929.1.74295 WP_000825929.1.74327 WP_000825929.1.74456 WP_000825929.1.74468 WP_000825929.1.74576 WP_000825929.1.74645 WP_000825929.1.74676 WP_000825929.1.74681 WP_000825929.1.74758 WP_000825929.1.74761 WP_000825929.1.74770 WP_000825929.1.74785 WP_000825929.1.74797 WP_000825929.1.7482 WP_000825929.1.74840 WP_000825929.1.74874 WP_000825929.1.75070 WP_000825929.1.75111 WP_000825929.1.75131 WP_000825929.1.75132 WP_000825929.1.75323 WP_000825929.1.75351 WP_000825929.1.75356 WP_000825929.1.75409 WP_000825929.1.75538 WP_000825929.1.75566 WP_000825929.1.75571 WP_000825929.1.75647 WP_000825929.1.75692 WP_000825929.1.75728 WP_000825929.1.75743 WP_000825929.1.75800 WP_000825929.1.75809 WP_000825929.1.75840 WP_000825929.1.75848 WP_000825929.1.75862 WP_000825929.1.75910 WP_000825929.1.76013 WP_000825929.1.7602 WP_000825929.1.76047 WP_000825929.1.76049 WP_000825929.1.76050 WP_000825929.1.76053 WP_000825929.1.76111 WP_000825929.1.76114 WP_000825929.1.76121 WP_000825929.1.76149 WP_000825929.1.76153 WP_000825929.1.76179 WP_000825929.1.7627 WP_000825929.1.76282 WP_000825929.1.76283 WP_000825929.1.76313 WP_000825929.1.76424 WP_000825929.1.76426 WP_000825929.1.76431 WP_000825929.1.76463 WP_000825929.1.76497 WP_000825929.1.765 WP_000825929.1.7658 WP_000825929.1.76674 WP_000825929.1.76711 WP_000825929.1.76718 WP_000825929.1.76798 WP_000825929.1.76803 WP_000825929.1.76820 WP_000825929.1.76825 WP_000825929.1.76829 WP_000825929.1.7694 WP_000825929.1.77043 WP_000825929.1.77072 WP_000825929.1.77137 WP_000825929.1.77158 WP_000825929.1.77187 WP_000825929.1.77190 WP_000825929.1.77203 WP_000825929.1.77229 WP_000825929.1.77297 WP_000825929.1.77298 WP_000825929.1.77331 WP_000825929.1.77346 WP_000825929.1.77359 WP_000825929.1.77388 WP_000825929.1.77460 WP_000825929.1.77485 WP_000825929.1.77498 WP_000825929.1.77532 WP_000825929.1.77650 WP_000825929.1.77733 WP_000825929.1.77735 WP_000825929.1.77791 WP_000825929.1.7785 WP_000825929.1.7786 WP_000825929.1.77882 WP_000825929.1.77893 WP_000825929.1.77915 WP_000825929.1.77922 WP_000825929.1.77930 WP_000825929.1.77952 WP_000825929.1.77986 WP_000825929.1.78038 WP_000825929.1.78082 WP_000825929.1.78093 WP_000825929.1.78095 WP_000825929.1.78164 WP_000825929.1.78179 WP_000825929.1.78194 WP_000825929.1.78304 WP_000825929.1.7833 WP_000825929.1.78330 WP_000825929.1.78335 WP_000825929.1.78371 WP_000825929.1.78392 WP_000825929.1.78434 WP_000825929.1.78436 WP_000825929.1.78470 WP_000825929.1.78489 WP_000825929.1.78494 WP_000825929.1.7853 WP_000825929.1.78573 WP_000825929.1.78585 WP_000825929.1.78592 WP_000825929.1.78598 WP_000825929.1.78662 WP_000825929.1.7868 WP_000825929.1.78685 WP_000825929.1.78736 WP_000825929.1.78758 WP_000825929.1.78763 WP_000825929.1.78816 WP_000825929.1.78920 WP_000825929.1.78937 WP_000825929.1.78985 WP_000825929.1.78991 WP_000825929.1.78995 WP_000825929.1.7905 WP_000825929.1.79110 WP_000825929.1.7914 WP_000825929.1.79143 WP_000825929.1.79178 WP_000825929.1.79192 WP_000825929.1.79227 WP_000825929.1.79270 WP_000825929.1.79275 WP_000825929.1.79285 WP_000825929.1.79378 WP_000825929.1.79402 WP_000825929.1.79408 WP_000825929.1.79552 WP_000825929.1.79581 WP_000825929.1.79627 WP_000825929.1.79664 WP_000825929.1.79676 WP_000825929.1.79677 WP_000825929.1.79731 WP_000825929.1.79763 WP_000825929.1.7981 WP_000825929.1.79815 WP_000825929.1.79904 WP_000825929.1.79949 WP_000825929.1.80009 WP_000825929.1.80013 WP_000825929.1.80029 WP_000825929.1.80086 WP_000825929.1.80119 WP_000825929.1.80120 WP_000825929.1.80122 WP_000825929.1.80146 WP_000825929.1.80178 WP_000825929.1.80184 WP_000825929.1.80210 WP_000825929.1.80244 WP_000825929.1.80274 WP_000825929.1.80297 WP_000825929.1.80316 WP_000825929.1.80361 WP_000825929.1.80389 WP_000825929.1.80434 WP_000825929.1.8045 WP_000825929.1.80521 WP_000825929.1.80582 WP_000825929.1.80653 WP_000825929.1.80745 WP_000825929.1.80855 WP_000825929.1.80899 WP_000825929.1.81010 WP_000825929.1.81022 WP_000825929.1.81049 WP_000825929.1.81052 WP_000825929.1.81064 WP_000825929.1.81095 WP_000825929.1.81097 WP_000825929.1.81132 WP_000825929.1.81151 WP_000825929.1.81172 WP_000825929.1.81176 WP_000825929.1.81184 WP_000825929.1.81214 WP_000825929.1.81228 WP_000825929.1.81232 WP_000825929.1.81288 WP_000825929.1.81290 WP_000825929.1.81344 WP_000825929.1.81379 WP_000825929.1.81384 WP_000825929.1.81508 WP_000825929.1.81574 WP_000825929.1.8160 WP_000825929.1.81604 WP_000825929.1.81619 WP_000825929.1.81767 WP_000825929.1.8180 WP_000825929.1.81837 WP_000825929.1.81838 WP_000825929.1.8185 WP_000825929.1.81969 WP_000825929.1.81990 WP_000825929.1.8206 WP_000825929.1.82103 WP_000825929.1.8213 WP_000825929.1.82174 WP_000825929.1.82184 WP_000825929.1.82253 WP_000825929.1.82278 WP_000825929.1.82281 WP_000825929.1.82301 WP_000825929.1.82349 WP_000825929.1.82406 WP_000825929.1.82458 WP_000825929.1.82468 WP_000825929.1.82525 WP_000825929.1.82535 WP_000825929.1.82558 WP_000825929.1.8266 WP_000825929.1.82678 WP_000825929.1.82768 WP_000825929.1.82824 WP_000825929.1.82930 WP_000825929.1.82941 WP_000825929.1.83046 WP_000825929.1.83054 WP_000825929.1.83066 WP_000825929.1.83078 WP_000825929.1.83086 WP_000825929.1.83103 WP_000825929.1.8318 WP_000825929.1.83203 WP_000825929.1.8328 WP_000825929.1.83291 WP_000825929.1.83359 WP_000825929.1.83405 WP_000825929.1.83417 WP_000825929.1.8346 WP_000825929.1.83467 WP_000825929.1.83472 WP_000825929.1.83479 WP_000825929.1.83508 WP_000825929.1.83520 WP_000825929.1.83553 WP_000825929.1.83624 WP_000825929.1.83652 WP_000825929.1.8366 WP_000825929.1.83674 WP_000825929.1.83728 WP_000825929.1.83750 WP_000825929.1.83756 WP_000825929.1.83758 WP_000825929.1.83770 WP_000825929.1.83788 WP_000825929.1.83797 WP_000825929.1.83844 WP_000825929.1.8385 WP_000825929.1.83868 WP_000825929.1.83886 WP_000825929.1.83989 WP_000825929.1.84010 WP_000825929.1.84025 WP_000825929.1.84054 WP_000825929.1.84118 WP_000825929.1.84129 WP_000825929.1.84161 WP_000825929.1.84188 WP_000825929.1.84275 WP_000825929.1.84414 WP_000825929.1.84415 WP_000825929.1.84418 WP_000825929.1.84508 WP_000825929.1.84590 WP_000825929.1.84596 WP_000825929.1.84608 WP_000825929.1.8462 WP_000825929.1.84648 WP_000825929.1.84651 WP_000825929.1.84696 WP_000825929.1.84826 WP_000825929.1.84847 WP_000825929.1.84854 WP_000825929.1.84924 WP_000825929.1.84943 WP_000825929.1.8496 WP_000825929.1.84975 WP_000825929.1.84978 WP_000825929.1.85017 WP_000825929.1.85026 WP_000825929.1.85045 WP_000825929.1.85070 WP_000825929.1.85118 WP_000825929.1.85160 WP_000825929.1.85229 WP_000825929.1.85231 WP_000825929.1.85289 WP_000825929.1.85292 WP_000825929.1.85302 WP_000825929.1.85375 WP_000825929.1.85376 WP_000825929.1.85409 WP_000825929.1.85441 WP_000825929.1.85485 WP_000825929.1.8551 WP_000825929.1.85555 WP_000825929.1.85585 WP_000825929.1.85611 WP_000825929.1.85730 WP_000825929.1.85732 WP_000825929.1.85858 WP_000825929.1.85906 WP_000825929.1.85924 WP_000825929.1.85971 WP_000825929.1.85980 WP_000825929.1.86036 WP_000825929.1.86042 WP_000825929.1.86086 WP_000825929.1.8617 WP_000825929.1.862 WP_000825929.1.86209 WP_000825929.1.86248 WP_000825929.1.86281 WP_000825929.1.86315 WP_000825929.1.8636 WP_000825929.1.86363 WP_000825929.1.86390 WP_000825929.1.86473 WP_000825929.1.86531 WP_000825929.1.86606 WP_000825929.1.86664 WP_000825929.1.86704 WP_000825929.1.86736 WP_000825929.1.86745 WP_000825929.1.86779 WP_000825929.1.86793 WP_000825929.1.86795 WP_000825929.1.8690 WP_000825929.1.86942 WP_000825929.1.86968 WP_000825929.1.86999 WP_000825929.1.87088 WP_000825929.1.87097 WP_000825929.1.87100 WP_000825929.1.8712 WP_000825929.1.87133 WP_000825929.1.87137 WP_000825929.1.87168 WP_000825929.1.87190 WP_000825929.1.87204 WP_000825929.1.87221 WP_000825929.1.87272 WP_000825929.1.87296 WP_000825929.1.87363 WP_000825929.1.87372 WP_000825929.1.87388 WP_000825929.1.87486 WP_000825929.1.87511 WP_000825929.1.87541 WP_000825929.1.87595 WP_000825929.1.8764 WP_000825929.1.87734 WP_000825929.1.87745 WP_000825929.1.87782 WP_000825929.1.87854 WP_000825929.1.87865 WP_000825929.1.87937 WP_000825929.1.87967 WP_000825929.1.88169 WP_000825929.1.88309 WP_000825929.1.88311 WP_000825929.1.88373 WP_000825929.1.88375 WP_000825929.1.88418 WP_000825929.1.88430 WP_000825929.1.88440 WP_000825929.1.88449 WP_000825929.1.8847 WP_000825929.1.88473 WP_000825929.1.88563 WP_000825929.1.88585 WP_000825929.1.8859 WP_000825929.1.88600 WP_000825929.1.88614 WP_000825929.1.88696 WP_000825929.1.88753 WP_000825929.1.88761 WP_000825929.1.88771 WP_000825929.1.88781 WP_000825929.1.88843 WP_000825929.1.88878 WP_000825929.1.88954 WP_000825929.1.88960 WP_000825929.1.88962 WP_000825929.1.88987 WP_000825929.1.8899 WP_000825929.1.89012 WP_000825929.1.89024 WP_000825929.1.89036 WP_000825929.1.89125 WP_000825929.1.89164 WP_000825929.1.8918 WP_000825929.1.89184 WP_000825929.1.89262 WP_000825929.1.89290 WP_000825929.1.89348 WP_000825929.1.89350 WP_000825929.1.89390 WP_000825929.1.89404 WP_000825929.1.89433 WP_000825929.1.897 WP_000825929.1.89779 WP_000825929.1.89794 WP_000825929.1.898 WP_000825929.1.8986 WP_000825929.1.89863 WP_000825929.1.89908 WP_000825929.1.89949 WP_000825929.1.89950 WP_000825929.1.90069 WP_000825929.1.90173 WP_000825929.1.90174 WP_000825929.1.90217 WP_000825929.1.90246 WP_000825929.1.90250 WP_000825929.1.90386 WP_000825929.1.90447 WP_000825929.1.90454 WP_000825929.1.90475 WP_000825929.1.90488 WP_000825929.1.90506 WP_000825929.1.90533 WP_000825929.1.9055 WP_000825929.1.90556 WP_000825929.1.90661 WP_000825929.1.90698 WP_000825929.1.9071 WP_000825929.1.9076 WP_000825929.1.90923 WP_000825929.1.91005 WP_000825929.1.91019 WP_000825929.1.91124 WP_000825929.1.91150 WP_000825929.1.9122 WP_000825929.1.91280 WP_000825929.1.91287 WP_000825929.1.91447 WP_000825929.1.91486 WP_000825929.1.91525 WP_000825929.1.91530 WP_000825929.1.9155 WP_000825929.1.91586 WP_000825929.1.91611 WP_000825929.1.91634 WP_000825929.1.91670 WP_000825929.1.917 WP_000825929.1.91704 WP_000825929.1.91745 WP_000825929.1.91848 WP_000825929.1.91918 WP_000825929.1.91969 WP_000825929.1.92055 WP_000825929.1.92115 WP_000825929.1.92125 WP_000825929.1.92186 WP_000825929.1.92212 WP_000825929.1.92228 WP_000825929.1.92244 WP_000825929.1.92249 WP_000825929.1.92303 WP_000825929.1.92391 WP_000825929.1.92405 WP_000825929.1.92425 WP_000825929.1.9247 WP_000825929.1.92479 WP_000825929.1.92512 WP_000825929.1.92667 WP_000825929.1.92674 WP_000825929.1.92718 WP_000825929.1.92765 WP_000825929.1.92795 WP_000825929.1.9286 WP_000825929.1.92918 WP_000825929.1.9296 WP_000825929.1.92960 WP_000825929.1.92965 WP_000825929.1.92997 WP_000825929.1.93047 WP_000825929.1.9305 WP_000825929.1.93071 WP_000825929.1.93147 WP_000825929.1.93197 WP_000825929.1.93243 WP_000825929.1.93254 WP_000825929.1.93260 WP_000825929.1.93272 WP_000825929.1.93378 WP_000825929.1.93471 WP_000825929.1.93567 WP_000825929.1.93579 WP_000825929.1.93708 WP_000825929.1.93736 WP_000825929.1.93758 WP_000825929.1.93762 WP_000825929.1.93775 WP_000825929.1.93890 WP_000825929.1.94 WP_000825929.1.94053 WP_000825929.1.9408 WP_000825929.1.94080 WP_000825929.1.9411 WP_000825929.1.94122 WP_000825929.1.94123 WP_000825929.1.94130 WP_000825929.1.94242 WP_000825929.1.94245 WP_000825929.1.94248 WP_000825929.1.94268 WP_000825929.1.94287 WP_000825929.1.9430 WP_000825929.1.94320 WP_000825929.1.94324 WP_000825929.1.94337 WP_000825929.1.94341 WP_000825929.1.94484 WP_000825929.1.94505 WP_000825929.1.94536 WP_000825929.1.9455 WP_000825929.1.947 WP_000825929.1.94825 WP_000825929.1.94969 WP_000825929.1.95008 WP_000825929.1.95023 WP_000825929.1.95029 WP_000825929.1.95033 WP_000825929.1.95156 WP_000825929.1.95193 WP_000825929.1.95210 WP_000825929.1.95263 WP_000825929.1.95281 WP_000825929.1.95294 WP_000825929.1.95386 WP_000825929.1.95415 WP_000825929.1.9544 WP_000825929.1.95476 WP_000825929.1.95494 WP_000825929.1.95512 WP_000825929.1.95519 WP_000825929.1.95522 WP_000825929.1.95560 WP_000825929.1.9563 WP_000825929.1.95683 WP_000825929.1.95780 WP_000825929.1.95804 WP_000825929.1.95832 WP_000825929.1.959 WP_000825929.1.95962 WP_000825929.1.96022 WP_000825929.1.96160 WP_000825929.1.96163 WP_000825929.1.96165 WP_000825929.1.96209 WP_000825929.1.96218 WP_000825929.1.96271 WP_000825929.1.96305 WP_000825929.1.96316 WP_000825929.1.96468 WP_000825929.1.96568 WP_000825929.1.96634 WP_000825929.1.96646 WP_000825929.1.96654 WP_000825929.1.96682 WP_000825929.1.96688 WP_000825929.1.96727 WP_000825929.1.96770 WP_000825929.1.96804 WP_000825929.1.96854 WP_000825929.1.96895 WP_000825929.1.96918 WP_000825929.1.9695 WP_000825929.1.96976 WP_000825929.1.97001 WP_000825929.1.97007 WP_000825929.1.97017 WP_000825929.1.97072 WP_000825929.1.97117 WP_000825929.1.97138 WP_000825929.1.97139 WP_000825929.1.97191 WP_000825929.1.97267 WP_000825929.1.97295 WP_000825929.1.97411 WP_000825929.1.97466 WP_000825929.1.97468 WP_000825929.1.97484 WP_000825929.1.97536 WP_000825929.1.97574 WP_000825929.1.97627 WP_000825929.1.97717 WP_000825929.1.97731 WP_000825929.1.97739 WP_000825929.1.97758 WP_000825929.1.97786 WP_000825929.1.97827 WP_000825929.1.97835 WP_000825929.1.9789 WP_000825929.1.97899 WP_000825929.1.97928 WP_000825929.1.97999 WP_000825929.1.98011 WP_000825929.1.98033 WP_000825929.1.98051 WP_000825929.1.98191 WP_000825929.1.98242 WP_000825929.1.98361 WP_000825929.1.98379 WP_000825929.1.98411 WP_000825929.1.98415 WP_000825929.1.98456 WP_000825929.1.98497 WP_000825929.1.98512 WP_000825929.1.98552 WP_000825929.1.986 WP_000825929.1.98655 WP_000825929.1.98706 WP_000825929.1.98767 WP_000825929.1.98837 WP_000825929.1.98858 WP_000825929.1.98874 WP_000825929.1.98967 WP_000825929.1.99009 WP_000825929.1.99025 WP_000825929.1.9903 WP_000825929.1.9912 WP_000825929.1.99155 WP_000825929.1.99171 WP_000825929.1.99237 WP_000825929.1.99249 WP_000825929.1.99280 WP_000825929.1.99359 WP_000825929.1.9936 WP_000825929.1.99405 WP_000825929.1.99430 WP_000825929.1.99459 WP_000825929.1.99492 WP_000825929.1.99494 WP_000825929.1.99519 WP_000825929.1.99536 WP_000825929.1.99538 WP_000825929.1.99564 WP_000825929.1.99569 WP_000825929.1.9960 WP_000825929.1.99631 WP_000825929.1.99638 WP_000825929.1.99686 WP_000825929.1.99759 WP_000825929.1.99802 WP_000825929.1.99850 WP_000825929.1.99860 WP_000825929.1.9987 WP_000825929.1.99888 WP_000825929.1.99926 WP_000825929.1.99956 WP_000825929.1.99979 WP_000825929.1.99985 YP_501161.1.76163 gi|57650957|ref|YP_187215.1| gi|87162197|ref|YP_494994.1| gi|49487196|ref|YP_044417.1| gi|161510605|ref|YP_001576264.1| 196620.MW2336 282459.SAS2305 426430.NWMN_2313 451515.SAUSA300_2359 451516.USA300HOU_2395 93061.SAOUHSC_02699 93062.SACOL2412 gi|384863056|ref|YP_005745776.1| gi|479330416|ref|YP_007869475.1| gi|554645311|ref|YP_008717102.1| gi|384551193|ref|YP_005740445.1| gi|521213167|ref|YP_008169513.1| gi|88196339|ref|YP_501161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]