SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|521213199|ref|YP_008169545.1| from Staphylococcus aureus Bmb9393

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521213199|ref|YP_008169545.1|
Domain Number 1 Region: 34-304
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.04e-64
Family Phosphate binding protein-like 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|521213199|ref|YP_008169545.1|
Sequence length 313
Comment Glycine betaine/carnitine/choline-binding protein [Staphylococcus aureus Bmb9393]
Sequence
MKKIKYILVVFVLSLTVLSGCSLPGLGSKSTKNDVKITALSTSESQIISHMLRLLIEHDT
HGKIKPTLVNNLGSSTIQHNALINGDANISGVRYNGTDLTGALKEAPIKNPKKAMIATQQ
GFKKKFDQTFFDSYGFANTYAFMVTKETAKKYHLETVSDLAKHSKDLRLGMDSSWMNRKG
DGYEGFKKEYGFDFGTVRPMQIGLVYDALNSEKLDVALGYSTDGRIAAYDLKVLKDDKQF
FPPYAASAVATNELLRQHPELKTTINKLTGKISTSEMQRLNYEADGKGKEPAVVAEEFLK
KHHYFDKQKGGHK
Download sequence
Identical sequences A0A0D3QAE7 A0A0E1ANP8 A0A0H2WZC8 A0A0H2XIQ0 A0A0H3KAC9 A0A1E8WNJ1 A0A2K1A8A6 Q2FVH0
gi|479330448|ref|YP_007869507.1| gi|385782675|ref|YP_005758846.1| gi|384870997|ref|YP_005753711.1| gi|161510645|ref|YP_001576304.1| gi|379015567|ref|YP_005291803.1| gi|387144144|ref|YP_005732538.1| gi|57652261|ref|YP_187250.1| gi|521213199|ref|YP_008169545.1| gi|384863087|ref|YP_005745807.1| WP_000721553.1.100013 WP_000721553.1.100041 WP_000721553.1.100049 WP_000721553.1.100057 WP_000721553.1.100067 WP_000721553.1.100072 WP_000721553.1.100088 WP_000721553.1.100090 WP_000721553.1.100094 WP_000721553.1.100154 WP_000721553.1.100180 WP_000721553.1.100189 WP_000721553.1.100298 WP_000721553.1.100307 WP_000721553.1.100352 WP_000721553.1.100391 WP_000721553.1.10041 WP_000721553.1.100618 WP_000721553.1.100631 WP_000721553.1.100647 WP_000721553.1.100761 WP_000721553.1.100768 WP_000721553.1.100834 WP_000721553.1.100903 WP_000721553.1.100920 WP_000721553.1.100963 WP_000721553.1.100981 WP_000721553.1.100987 WP_000721553.1.101017 WP_000721553.1.101084 WP_000721553.1.101177 WP_000721553.1.101240 WP_000721553.1.101266 WP_000721553.1.101327 WP_000721553.1.101375 WP_000721553.1.101393 WP_000721553.1.101490 WP_000721553.1.101505 WP_000721553.1.101566 WP_000721553.1.101570 WP_000721553.1.101615 WP_000721553.1.10166 WP_000721553.1.101725 WP_000721553.1.101757 WP_000721553.1.101788 WP_000721553.1.101950 WP_000721553.1.102070 WP_000721553.1.1022 WP_000721553.1.10232 WP_000721553.1.10397 WP_000721553.1.10431 WP_000721553.1.10503 WP_000721553.1.1052 WP_000721553.1.10542 WP_000721553.1.10543 WP_000721553.1.10565 WP_000721553.1.10614 WP_000721553.1.10679 WP_000721553.1.10707 WP_000721553.1.10726 WP_000721553.1.10742 WP_000721553.1.1087 WP_000721553.1.10950 WP_000721553.1.11129 WP_000721553.1.1120 WP_000721553.1.11287 WP_000721553.1.11294 WP_000721553.1.11348 WP_000721553.1.11353 WP_000721553.1.1136 WP_000721553.1.11377 WP_000721553.1.11407 WP_000721553.1.11488 WP_000721553.1.11492 WP_000721553.1.11525 WP_000721553.1.11558 WP_000721553.1.11592 WP_000721553.1.11655 WP_000721553.1.11665 WP_000721553.1.11692 WP_000721553.1.117 WP_000721553.1.11719 WP_000721553.1.11720 WP_000721553.1.11795 WP_000721553.1.11829 WP_000721553.1.11991 WP_000721553.1.12005 WP_000721553.1.1205 WP_000721553.1.12073 WP_000721553.1.12098 WP_000721553.1.12123 WP_000721553.1.12179 WP_000721553.1.12181 WP_000721553.1.12226 WP_000721553.1.12233 WP_000721553.1.12297 WP_000721553.1.12328 WP_000721553.1.12447 WP_000721553.1.12498 WP_000721553.1.12639 WP_000721553.1.12715 WP_000721553.1.12771 WP_000721553.1.12822 WP_000721553.1.12833 WP_000721553.1.12845 WP_000721553.1.12862 WP_000721553.1.12903 WP_000721553.1.12937 WP_000721553.1.12938 WP_000721553.1.13039 WP_000721553.1.13072 WP_000721553.1.13091 WP_000721553.1.13104 WP_000721553.1.13322 WP_000721553.1.13468 WP_000721553.1.1347 WP_000721553.1.13486 WP_000721553.1.13531 WP_000721553.1.1355 WP_000721553.1.13556 WP_000721553.1.13568 WP_000721553.1.13617 WP_000721553.1.13650 WP_000721553.1.13654 WP_000721553.1.13683 WP_000721553.1.13726 WP_000721553.1.13727 WP_000721553.1.1374 WP_000721553.1.13755 WP_000721553.1.13757 WP_000721553.1.13772 WP_000721553.1.13804 WP_000721553.1.13805 WP_000721553.1.13914 WP_000721553.1.13940 WP_000721553.1.13983 WP_000721553.1.14071 WP_000721553.1.14112 WP_000721553.1.14153 WP_000721553.1.14233 WP_000721553.1.1426 WP_000721553.1.14364 WP_000721553.1.14365 WP_000721553.1.14366 WP_000721553.1.14394 WP_000721553.1.14418 WP_000721553.1.14475 WP_000721553.1.14590 WP_000721553.1.147 WP_000721553.1.14744 WP_000721553.1.1477 WP_000721553.1.14790 WP_000721553.1.14809 WP_000721553.1.14869 WP_000721553.1.14888 WP_000721553.1.14902 WP_000721553.1.14987 WP_000721553.1.15000 WP_000721553.1.15091 WP_000721553.1.15098 WP_000721553.1.15228 WP_000721553.1.15255 WP_000721553.1.15263 WP_000721553.1.15278 WP_000721553.1.15329 WP_000721553.1.15399 WP_000721553.1.15409 WP_000721553.1.15438 WP_000721553.1.1545 WP_000721553.1.15489 WP_000721553.1.15505 WP_000721553.1.15524 WP_000721553.1.15572 WP_000721553.1.15687 WP_000721553.1.1569 WP_000721553.1.15706 WP_000721553.1.1579 WP_000721553.1.15818 WP_000721553.1.1583 WP_000721553.1.15838 WP_000721553.1.15883 WP_000721553.1.15892 WP_000721553.1.15897 WP_000721553.1.15898 WP_000721553.1.15928 WP_000721553.1.15957 WP_000721553.1.15972 WP_000721553.1.1600 WP_000721553.1.1606 WP_000721553.1.16112 WP_000721553.1.16213 WP_000721553.1.16237 WP_000721553.1.16362 WP_000721553.1.16417 WP_000721553.1.16554 WP_000721553.1.16569 WP_000721553.1.16603 WP_000721553.1.16617 WP_000721553.1.16628 WP_000721553.1.16672 WP_000721553.1.16679 WP_000721553.1.16688 WP_000721553.1.16703 WP_000721553.1.16757 WP_000721553.1.16768 WP_000721553.1.16770 WP_000721553.1.16776 WP_000721553.1.16892 WP_000721553.1.16946 WP_000721553.1.17038 WP_000721553.1.17104 WP_000721553.1.17137 WP_000721553.1.17169 WP_000721553.1.17210 WP_000721553.1.17231 WP_000721553.1.17234 WP_000721553.1.17249 WP_000721553.1.1725 WP_000721553.1.17256 WP_000721553.1.17320 WP_000721553.1.17450 WP_000721553.1.17485 WP_000721553.1.17520 WP_000721553.1.17581 WP_000721553.1.17650 WP_000721553.1.17657 WP_000721553.1.17666 WP_000721553.1.17676 WP_000721553.1.17729 WP_000721553.1.17770 WP_000721553.1.17834 WP_000721553.1.17845 WP_000721553.1.17859 WP_000721553.1.17876 WP_000721553.1.17929 WP_000721553.1.17951 WP_000721553.1.18016 WP_000721553.1.18035 WP_000721553.1.18074 WP_000721553.1.18105 WP_000721553.1.18197 WP_000721553.1.18283 WP_000721553.1.18290 WP_000721553.1.18320 WP_000721553.1.18346 WP_000721553.1.1835 WP_000721553.1.18437 WP_000721553.1.18451 WP_000721553.1.1851 WP_000721553.1.18516 WP_000721553.1.18527 WP_000721553.1.18529 WP_000721553.1.18538 WP_000721553.1.18562 WP_000721553.1.18611 WP_000721553.1.18627 WP_000721553.1.18668 WP_000721553.1.18758 WP_000721553.1.18809 WP_000721553.1.18830 WP_000721553.1.18836 WP_000721553.1.18879 WP_000721553.1.18918 WP_000721553.1.18938 WP_000721553.1.18987 WP_000721553.1.19009 WP_000721553.1.1901 WP_000721553.1.19027 WP_000721553.1.19149 WP_000721553.1.19179 WP_000721553.1.192 WP_000721553.1.19272 WP_000721553.1.19390 WP_000721553.1.19411 WP_000721553.1.19444 WP_000721553.1.19509 WP_000721553.1.19575 WP_000721553.1.19733 WP_000721553.1.1975 WP_000721553.1.19765 WP_000721553.1.19775 WP_000721553.1.19807 WP_000721553.1.19853 WP_000721553.1.20057 WP_000721553.1.20101 WP_000721553.1.2013 WP_000721553.1.20155 WP_000721553.1.20160 WP_000721553.1.20210 WP_000721553.1.20235 WP_000721553.1.20265 WP_000721553.1.20354 WP_000721553.1.20386 WP_000721553.1.20473 WP_000721553.1.20554 WP_000721553.1.20772 WP_000721553.1.20833 WP_000721553.1.20838 WP_000721553.1.20860 WP_000721553.1.20975 WP_000721553.1.21013 WP_000721553.1.21054 WP_000721553.1.21080 WP_000721553.1.21081 WP_000721553.1.2128 WP_000721553.1.21312 WP_000721553.1.21356 WP_000721553.1.21386 WP_000721553.1.21402 WP_000721553.1.21465 WP_000721553.1.2154 WP_000721553.1.21583 WP_000721553.1.21601 WP_000721553.1.21679 WP_000721553.1.21712 WP_000721553.1.21820 WP_000721553.1.21890 WP_000721553.1.21901 WP_000721553.1.22045 WP_000721553.1.22149 WP_000721553.1.22163 WP_000721553.1.22165 WP_000721553.1.22170 WP_000721553.1.22174 WP_000721553.1.22246 WP_000721553.1.22332 WP_000721553.1.22344 WP_000721553.1.22351 WP_000721553.1.22367 WP_000721553.1.22526 WP_000721553.1.22551 WP_000721553.1.22657 WP_000721553.1.22730 WP_000721553.1.22731 WP_000721553.1.2280 WP_000721553.1.22811 WP_000721553.1.22843 WP_000721553.1.22859 WP_000721553.1.22994 WP_000721553.1.23004 WP_000721553.1.23152 WP_000721553.1.23197 WP_000721553.1.23228 WP_000721553.1.23238 WP_000721553.1.23381 WP_000721553.1.23420 WP_000721553.1.23450 WP_000721553.1.23491 WP_000721553.1.23541 WP_000721553.1.23544 WP_000721553.1.23586 WP_000721553.1.23613 WP_000721553.1.23626 WP_000721553.1.2365 WP_000721553.1.23822 WP_000721553.1.23849 WP_000721553.1.23907 WP_000721553.1.23935 WP_000721553.1.23998 WP_000721553.1.24148 WP_000721553.1.24167 WP_000721553.1.2423 WP_000721553.1.24241 WP_000721553.1.24279 WP_000721553.1.24364 WP_000721553.1.24418 WP_000721553.1.2442 WP_000721553.1.24443 WP_000721553.1.24462 WP_000721553.1.24478 WP_000721553.1.2458 WP_000721553.1.24617 WP_000721553.1.24745 WP_000721553.1.24781 WP_000721553.1.2480 WP_000721553.1.24802 WP_000721553.1.24891 WP_000721553.1.25083 WP_000721553.1.25170 WP_000721553.1.25438 WP_000721553.1.25469 WP_000721553.1.25479 WP_000721553.1.25511 WP_000721553.1.25567 WP_000721553.1.25593 WP_000721553.1.25634 WP_000721553.1.25737 WP_000721553.1.25770 WP_000721553.1.2579 WP_000721553.1.25820 WP_000721553.1.25867 WP_000721553.1.25868 WP_000721553.1.25881 WP_000721553.1.25891 WP_000721553.1.25924 WP_000721553.1.2593 WP_000721553.1.26006 WP_000721553.1.26015 WP_000721553.1.262 WP_000721553.1.26293 WP_000721553.1.26307 WP_000721553.1.26370 WP_000721553.1.26405 WP_000721553.1.26481 WP_000721553.1.2656 WP_000721553.1.2658 WP_000721553.1.2661 WP_000721553.1.26626 WP_000721553.1.2664 WP_000721553.1.26663 WP_000721553.1.26733 WP_000721553.1.26771 WP_000721553.1.26790 WP_000721553.1.26927 WP_000721553.1.26958 WP_000721553.1.27042 WP_000721553.1.27154 WP_000721553.1.27246 WP_000721553.1.27311 WP_000721553.1.27333 WP_000721553.1.2734 WP_000721553.1.27345 WP_000721553.1.27455 WP_000721553.1.27457 WP_000721553.1.27551 WP_000721553.1.27562 WP_000721553.1.2759 WP_000721553.1.27608 WP_000721553.1.27614 WP_000721553.1.27615 WP_000721553.1.27621 WP_000721553.1.27654 WP_000721553.1.27670 WP_000721553.1.2768 WP_000721553.1.27717 WP_000721553.1.27748 WP_000721553.1.27817 WP_000721553.1.27854 WP_000721553.1.27950 WP_000721553.1.27953 WP_000721553.1.27972 WP_000721553.1.28007 WP_000721553.1.28025 WP_000721553.1.28063 WP_000721553.1.28071 WP_000721553.1.28088 WP_000721553.1.28117 WP_000721553.1.28138 WP_000721553.1.28147 WP_000721553.1.28158 WP_000721553.1.28191 WP_000721553.1.28207 WP_000721553.1.28358 WP_000721553.1.28360 WP_000721553.1.28376 WP_000721553.1.28381 WP_000721553.1.28477 WP_000721553.1.28498 WP_000721553.1.28502 WP_000721553.1.28527 WP_000721553.1.28532 WP_000721553.1.28629 WP_000721553.1.28650 WP_000721553.1.28710 WP_000721553.1.28725 WP_000721553.1.28862 WP_000721553.1.28887 WP_000721553.1.28933 WP_000721553.1.28960 WP_000721553.1.28970 WP_000721553.1.29090 WP_000721553.1.29107 WP_000721553.1.29188 WP_000721553.1.29207 WP_000721553.1.29272 WP_000721553.1.29282 WP_000721553.1.29285 WP_000721553.1.29312 WP_000721553.1.29372 WP_000721553.1.29373 WP_000721553.1.29381 WP_000721553.1.29511 WP_000721553.1.29541 WP_000721553.1.29561 WP_000721553.1.29596 WP_000721553.1.29644 WP_000721553.1.29676 WP_000721553.1.2975 WP_000721553.1.29758 WP_000721553.1.29781 WP_000721553.1.29805 WP_000721553.1.29885 WP_000721553.1.29963 WP_000721553.1.30012 WP_000721553.1.30023 WP_000721553.1.30033 WP_000721553.1.30047 WP_000721553.1.30057 WP_000721553.1.30154 WP_000721553.1.30176 WP_000721553.1.30274 WP_000721553.1.30367 WP_000721553.1.30376 WP_000721553.1.30381 WP_000721553.1.30418 WP_000721553.1.30422 WP_000721553.1.30458 WP_000721553.1.30477 WP_000721553.1.30530 WP_000721553.1.30623 WP_000721553.1.30758 WP_000721553.1.30779 WP_000721553.1.30862 WP_000721553.1.30863 WP_000721553.1.30874 WP_000721553.1.30878 WP_000721553.1.30889 WP_000721553.1.30916 WP_000721553.1.3097 WP_000721553.1.30970 WP_000721553.1.30971 WP_000721553.1.30998 WP_000721553.1.31037 WP_000721553.1.31068 WP_000721553.1.31124 WP_000721553.1.31194 WP_000721553.1.31232 WP_000721553.1.3132 WP_000721553.1.31376 WP_000721553.1.31462 WP_000721553.1.31478 WP_000721553.1.315 WP_000721553.1.31567 WP_000721553.1.31611 WP_000721553.1.31638 WP_000721553.1.31667 WP_000721553.1.31787 WP_000721553.1.31797 WP_000721553.1.31817 WP_000721553.1.31897 WP_000721553.1.31925 WP_000721553.1.31949 WP_000721553.1.31990 WP_000721553.1.31994 WP_000721553.1.32059 WP_000721553.1.32118 WP_000721553.1.32122 WP_000721553.1.32125 WP_000721553.1.32167 WP_000721553.1.32217 WP_000721553.1.32244 WP_000721553.1.32248 WP_000721553.1.32281 WP_000721553.1.32295 WP_000721553.1.32365 WP_000721553.1.32384 WP_000721553.1.32405 WP_000721553.1.3244 WP_000721553.1.32454 WP_000721553.1.32464 WP_000721553.1.32555 WP_000721553.1.32739 WP_000721553.1.32839 WP_000721553.1.32987 WP_000721553.1.3299 WP_000721553.1.3306 WP_000721553.1.33108 WP_000721553.1.33147 WP_000721553.1.33213 WP_000721553.1.33252 WP_000721553.1.33255 WP_000721553.1.33307 WP_000721553.1.3335 WP_000721553.1.33350 WP_000721553.1.33372 WP_000721553.1.3338 WP_000721553.1.33388 WP_000721553.1.33394 WP_000721553.1.33426 WP_000721553.1.3345 WP_000721553.1.33463 WP_000721553.1.33483 WP_000721553.1.33484 WP_000721553.1.33520 WP_000721553.1.33575 WP_000721553.1.33650 WP_000721553.1.33724 WP_000721553.1.33737 WP_000721553.1.33756 WP_000721553.1.33766 WP_000721553.1.33778 WP_000721553.1.33899 WP_000721553.1.33949 WP_000721553.1.33994 WP_000721553.1.34069 WP_000721553.1.34105 WP_000721553.1.34112 WP_000721553.1.3418 WP_000721553.1.34194 WP_000721553.1.34361 WP_000721553.1.3442 WP_000721553.1.34471 WP_000721553.1.34512 WP_000721553.1.34569 WP_000721553.1.34620 WP_000721553.1.34716 WP_000721553.1.34723 WP_000721553.1.3474 WP_000721553.1.34741 WP_000721553.1.34847 WP_000721553.1.34865 WP_000721553.1.34923 WP_000721553.1.34926 WP_000721553.1.34967 WP_000721553.1.35014 WP_000721553.1.35031 WP_000721553.1.35032 WP_000721553.1.35289 WP_000721553.1.35314 WP_000721553.1.35340 WP_000721553.1.35391 WP_000721553.1.35413 WP_000721553.1.3542 WP_000721553.1.35508 WP_000721553.1.35517 WP_000721553.1.35519 WP_000721553.1.35549 WP_000721553.1.35642 WP_000721553.1.35661 WP_000721553.1.35686 WP_000721553.1.35696 WP_000721553.1.35784 WP_000721553.1.3579 WP_000721553.1.35837 WP_000721553.1.35888 WP_000721553.1.35890 WP_000721553.1.35903 WP_000721553.1.36093 WP_000721553.1.36179 WP_000721553.1.36208 WP_000721553.1.36249 WP_000721553.1.36302 WP_000721553.1.36430 WP_000721553.1.36434 WP_000721553.1.36439 WP_000721553.1.36704 WP_000721553.1.36729 WP_000721553.1.36773 WP_000721553.1.36814 WP_000721553.1.36847 WP_000721553.1.36888 WP_000721553.1.36903 WP_000721553.1.36911 WP_000721553.1.3709 WP_000721553.1.37120 WP_000721553.1.37130 WP_000721553.1.37145 WP_000721553.1.37159 WP_000721553.1.3722 WP_000721553.1.37240 WP_000721553.1.37335 WP_000721553.1.37378 WP_000721553.1.37411 WP_000721553.1.37435 WP_000721553.1.37546 WP_000721553.1.37644 WP_000721553.1.37669 WP_000721553.1.37679 WP_000721553.1.3774 WP_000721553.1.37749 WP_000721553.1.37764 WP_000721553.1.37771 WP_000721553.1.37788 WP_000721553.1.37851 WP_000721553.1.37906 WP_000721553.1.37907 WP_000721553.1.37929 WP_000721553.1.38030 WP_000721553.1.38111 WP_000721553.1.38128 WP_000721553.1.38136 WP_000721553.1.38222 WP_000721553.1.38304 WP_000721553.1.38516 WP_000721553.1.38555 WP_000721553.1.38688 WP_000721553.1.3875 WP_000721553.1.38875 WP_000721553.1.38885 WP_000721553.1.38890 WP_000721553.1.38927 WP_000721553.1.39017 WP_000721553.1.39026 WP_000721553.1.39126 WP_000721553.1.39166 WP_000721553.1.39330 WP_000721553.1.39361 WP_000721553.1.39432 WP_000721553.1.39451 WP_000721553.1.39499 WP_000721553.1.39542 WP_000721553.1.39642 WP_000721553.1.39670 WP_000721553.1.39671 WP_000721553.1.39682 WP_000721553.1.39693 WP_000721553.1.39857 WP_000721553.1.39943 WP_000721553.1.39995 WP_000721553.1.40076 WP_000721553.1.4010 WP_000721553.1.40149 WP_000721553.1.40247 WP_000721553.1.40299 WP_000721553.1.40329 WP_000721553.1.40369 WP_000721553.1.40428 WP_000721553.1.40483 WP_000721553.1.40500 WP_000721553.1.40670 WP_000721553.1.40700 WP_000721553.1.40719 WP_000721553.1.40729 WP_000721553.1.40780 WP_000721553.1.40814 WP_000721553.1.40939 WP_000721553.1.40997 WP_000721553.1.41033 WP_000721553.1.41038 WP_000721553.1.4105 WP_000721553.1.41350 WP_000721553.1.41374 WP_000721553.1.41386 WP_000721553.1.41389 WP_000721553.1.41555 WP_000721553.1.41581 WP_000721553.1.41587 WP_000721553.1.41598 WP_000721553.1.41612 WP_000721553.1.41620 WP_000721553.1.41681 WP_000721553.1.4169 WP_000721553.1.41743 WP_000721553.1.41755 WP_000721553.1.41796 WP_000721553.1.4182 WP_000721553.1.41863 WP_000721553.1.41972 WP_000721553.1.42003 WP_000721553.1.4202 WP_000721553.1.42056 WP_000721553.1.42072 WP_000721553.1.42085 WP_000721553.1.42169 WP_000721553.1.42178 WP_000721553.1.42241 WP_000721553.1.4225 WP_000721553.1.42298 WP_000721553.1.42325 WP_000721553.1.42344 WP_000721553.1.42607 WP_000721553.1.42679 WP_000721553.1.42681 WP_000721553.1.42733 WP_000721553.1.42764 WP_000721553.1.42788 WP_000721553.1.42798 WP_000721553.1.42883 WP_000721553.1.42907 WP_000721553.1.42925 WP_000721553.1.42959 WP_000721553.1.42984 WP_000721553.1.42990 WP_000721553.1.43023 WP_000721553.1.43061 WP_000721553.1.43095 WP_000721553.1.43110 WP_000721553.1.43125 WP_000721553.1.43139 WP_000721553.1.43168 WP_000721553.1.43179 WP_000721553.1.43204 WP_000721553.1.43252 WP_000721553.1.43279 WP_000721553.1.43331 WP_000721553.1.43360 WP_000721553.1.43375 WP_000721553.1.43405 WP_000721553.1.43446 WP_000721553.1.43512 WP_000721553.1.43665 WP_000721553.1.43683 WP_000721553.1.43784 WP_000721553.1.4386 WP_000721553.1.43984 WP_000721553.1.43995 WP_000721553.1.44074 WP_000721553.1.44177 WP_000721553.1.44178 WP_000721553.1.44344 WP_000721553.1.44382 WP_000721553.1.44432 WP_000721553.1.44504 WP_000721553.1.44515 WP_000721553.1.44517 WP_000721553.1.44520 WP_000721553.1.44586 WP_000721553.1.44623 WP_000721553.1.44655 WP_000721553.1.44667 WP_000721553.1.447 WP_000721553.1.44714 WP_000721553.1.44715 WP_000721553.1.44856 WP_000721553.1.44868 WP_000721553.1.44876 WP_000721553.1.44892 WP_000721553.1.44940 WP_000721553.1.44993 WP_000721553.1.45042 WP_000721553.1.45080 WP_000721553.1.45091 WP_000721553.1.45094 WP_000721553.1.45132 WP_000721553.1.45140 WP_000721553.1.45157 WP_000721553.1.45162 WP_000721553.1.45223 WP_000721553.1.45242 WP_000721553.1.45267 WP_000721553.1.4527 WP_000721553.1.45281 WP_000721553.1.4545 WP_000721553.1.45450 WP_000721553.1.45456 WP_000721553.1.4546 WP_000721553.1.45542 WP_000721553.1.45555 WP_000721553.1.45574 WP_000721553.1.45610 WP_000721553.1.45620 WP_000721553.1.45645 WP_000721553.1.45705 WP_000721553.1.45763 WP_000721553.1.4577 WP_000721553.1.45773 WP_000721553.1.4582 WP_000721553.1.45859 WP_000721553.1.45862 WP_000721553.1.45874 WP_000721553.1.4597 WP_000721553.1.45972 WP_000721553.1.45977 WP_000721553.1.45979 WP_000721553.1.46037 WP_000721553.1.46050 WP_000721553.1.46062 WP_000721553.1.46078 WP_000721553.1.46171 WP_000721553.1.46172 WP_000721553.1.46185 WP_000721553.1.46248 WP_000721553.1.46333 WP_000721553.1.46339 WP_000721553.1.46529 WP_000721553.1.46619 WP_000721553.1.46648 WP_000721553.1.46720 WP_000721553.1.46736 WP_000721553.1.46770 WP_000721553.1.4680 WP_000721553.1.46906 WP_000721553.1.46914 WP_000721553.1.46929 WP_000721553.1.4694 WP_000721553.1.46947 WP_000721553.1.47065 WP_000721553.1.47107 WP_000721553.1.47111 WP_000721553.1.47193 WP_000721553.1.47282 WP_000721553.1.47334 WP_000721553.1.47408 WP_000721553.1.47459 WP_000721553.1.47522 WP_000721553.1.47617 WP_000721553.1.47669 WP_000721553.1.47680 WP_000721553.1.47747 WP_000721553.1.47851 WP_000721553.1.47908 WP_000721553.1.4792 WP_000721553.1.48046 WP_000721553.1.48064 WP_000721553.1.48067 WP_000721553.1.48116 WP_000721553.1.48142 WP_000721553.1.48156 WP_000721553.1.48187 WP_000721553.1.48223 WP_000721553.1.48272 WP_000721553.1.48310 WP_000721553.1.48338 WP_000721553.1.48376 WP_000721553.1.48398 WP_000721553.1.4840 WP_000721553.1.48427 WP_000721553.1.48437 WP_000721553.1.48438 WP_000721553.1.48479 WP_000721553.1.4852 WP_000721553.1.48580 WP_000721553.1.48664 WP_000721553.1.48670 WP_000721553.1.48723 WP_000721553.1.48769 WP_000721553.1.48782 WP_000721553.1.48869 WP_000721553.1.49018 WP_000721553.1.49071 WP_000721553.1.49094 WP_000721553.1.49105 WP_000721553.1.49171 WP_000721553.1.49189 WP_000721553.1.49196 WP_000721553.1.49199 WP_000721553.1.4924 WP_000721553.1.49257 WP_000721553.1.49301 WP_000721553.1.49326 WP_000721553.1.49362 WP_000721553.1.49418 WP_000721553.1.4945 WP_000721553.1.49518 WP_000721553.1.49549 WP_000721553.1.49581 WP_000721553.1.49582 WP_000721553.1.496 WP_000721553.1.49603 WP_000721553.1.49643 WP_000721553.1.49672 WP_000721553.1.49690 WP_000721553.1.49728 WP_000721553.1.49732 WP_000721553.1.49745 WP_000721553.1.49819 WP_000721553.1.4982 WP_000721553.1.49918 WP_000721553.1.49935 WP_000721553.1.50028 WP_000721553.1.50117 WP_000721553.1.50145 WP_000721553.1.50178 WP_000721553.1.50192 WP_000721553.1.50291 WP_000721553.1.50367 WP_000721553.1.50369 WP_000721553.1.50388 WP_000721553.1.5045 WP_000721553.1.50464 WP_000721553.1.50525 WP_000721553.1.50558 WP_000721553.1.50568 WP_000721553.1.5059 WP_000721553.1.50594 WP_000721553.1.50647 WP_000721553.1.50699 WP_000721553.1.50740 WP_000721553.1.50817 WP_000721553.1.50829 WP_000721553.1.50974 WP_000721553.1.51015 WP_000721553.1.5108 WP_000721553.1.51130 WP_000721553.1.51209 WP_000721553.1.51226 WP_000721553.1.51271 WP_000721553.1.51277 WP_000721553.1.51326 WP_000721553.1.51393 WP_000721553.1.51496 WP_000721553.1.51557 WP_000721553.1.51741 WP_000721553.1.51794 WP_000721553.1.51824 WP_000721553.1.52034 WP_000721553.1.52061 WP_000721553.1.52072 WP_000721553.1.52195 WP_000721553.1.52198 WP_000721553.1.52210 WP_000721553.1.52289 WP_000721553.1.52308 WP_000721553.1.5231 WP_000721553.1.52343 WP_000721553.1.52377 WP_000721553.1.52396 WP_000721553.1.52427 WP_000721553.1.52452 WP_000721553.1.5251 WP_000721553.1.52511 WP_000721553.1.52605 WP_000721553.1.52830 WP_000721553.1.52889 WP_000721553.1.52900 WP_000721553.1.52965 WP_000721553.1.52983 WP_000721553.1.5304 WP_000721553.1.53050 WP_000721553.1.53057 WP_000721553.1.5319 WP_000721553.1.53245 WP_000721553.1.53285 WP_000721553.1.53312 WP_000721553.1.53363 WP_000721553.1.53373 WP_000721553.1.53379 WP_000721553.1.53408 WP_000721553.1.53467 WP_000721553.1.5347 WP_000721553.1.53532 WP_000721553.1.53774 WP_000721553.1.53799 WP_000721553.1.53911 WP_000721553.1.53926 WP_000721553.1.54049 WP_000721553.1.54074 WP_000721553.1.54086 WP_000721553.1.54237 WP_000721553.1.54290 WP_000721553.1.54299 WP_000721553.1.54404 WP_000721553.1.54438 WP_000721553.1.54471 WP_000721553.1.54479 WP_000721553.1.54485 WP_000721553.1.54554 WP_000721553.1.54574 WP_000721553.1.54744 WP_000721553.1.54830 WP_000721553.1.54851 WP_000721553.1.54929 WP_000721553.1.54931 WP_000721553.1.54967 WP_000721553.1.54990 WP_000721553.1.5500 WP_000721553.1.55004 WP_000721553.1.55084 WP_000721553.1.55095 WP_000721553.1.55139 WP_000721553.1.5518 WP_000721553.1.55239 WP_000721553.1.55271 WP_000721553.1.55272 WP_000721553.1.55327 WP_000721553.1.55336 WP_000721553.1.55419 WP_000721553.1.55495 WP_000721553.1.5550 WP_000721553.1.55527 WP_000721553.1.55535 WP_000721553.1.55603 WP_000721553.1.5562 WP_000721553.1.55719 WP_000721553.1.55724 WP_000721553.1.55845 WP_000721553.1.55955 WP_000721553.1.56003 WP_000721553.1.5604 WP_000721553.1.56064 WP_000721553.1.56106 WP_000721553.1.56135 WP_000721553.1.56159 WP_000721553.1.56200 WP_000721553.1.56220 WP_000721553.1.56237 WP_000721553.1.56265 WP_000721553.1.56387 WP_000721553.1.56464 WP_000721553.1.56482 WP_000721553.1.56527 WP_000721553.1.56542 WP_000721553.1.56584 WP_000721553.1.56608 WP_000721553.1.56619 WP_000721553.1.56702 WP_000721553.1.56708 WP_000721553.1.56737 WP_000721553.1.5675 WP_000721553.1.56779 WP_000721553.1.56822 WP_000721553.1.56903 WP_000721553.1.56931 WP_000721553.1.56966 WP_000721553.1.56975 WP_000721553.1.57015 WP_000721553.1.5705 WP_000721553.1.57081 WP_000721553.1.57115 WP_000721553.1.57141 WP_000721553.1.57330 WP_000721553.1.57427 WP_000721553.1.57448 WP_000721553.1.57593 WP_000721553.1.57670 WP_000721553.1.57693 WP_000721553.1.57701 WP_000721553.1.57718 WP_000721553.1.57727 WP_000721553.1.57745 WP_000721553.1.57783 WP_000721553.1.57844 WP_000721553.1.57962 WP_000721553.1.5799 WP_000721553.1.58006 WP_000721553.1.58051 WP_000721553.1.58122 WP_000721553.1.5817 WP_000721553.1.58185 WP_000721553.1.58198 WP_000721553.1.58241 WP_000721553.1.58246 WP_000721553.1.58321 WP_000721553.1.58325 WP_000721553.1.58350 WP_000721553.1.58353 WP_000721553.1.58366 WP_000721553.1.58373 WP_000721553.1.58392 WP_000721553.1.58421 WP_000721553.1.58481 WP_000721553.1.5849 WP_000721553.1.58508 WP_000721553.1.58521 WP_000721553.1.586 WP_000721553.1.58603 WP_000721553.1.58714 WP_000721553.1.58775 WP_000721553.1.58936 WP_000721553.1.58998 WP_000721553.1.5901 WP_000721553.1.5904 WP_000721553.1.59133 WP_000721553.1.5925 WP_000721553.1.59269 WP_000721553.1.59284 WP_000721553.1.59327 WP_000721553.1.59337 WP_000721553.1.59363 WP_000721553.1.59397 WP_000721553.1.59457 WP_000721553.1.59459 WP_000721553.1.59467 WP_000721553.1.59478 WP_000721553.1.59489 WP_000721553.1.59603 WP_000721553.1.59609 WP_000721553.1.59629 WP_000721553.1.59663 WP_000721553.1.59697 WP_000721553.1.59803 WP_000721553.1.59881 WP_000721553.1.59886 WP_000721553.1.59977 WP_000721553.1.60022 WP_000721553.1.60086 WP_000721553.1.60156 WP_000721553.1.60181 WP_000721553.1.60251 WP_000721553.1.60259 WP_000721553.1.60280 WP_000721553.1.60307 WP_000721553.1.60368 WP_000721553.1.60462 WP_000721553.1.60515 WP_000721553.1.60551 WP_000721553.1.60594 WP_000721553.1.60690 WP_000721553.1.60696 WP_000721553.1.60787 WP_000721553.1.60898 WP_000721553.1.60939 WP_000721553.1.60981 WP_000721553.1.61030 WP_000721553.1.61119 WP_000721553.1.61152 WP_000721553.1.61153 WP_000721553.1.6118 WP_000721553.1.61188 WP_000721553.1.61257 WP_000721553.1.61324 WP_000721553.1.61339 WP_000721553.1.61408 WP_000721553.1.61413 WP_000721553.1.61421 WP_000721553.1.61547 WP_000721553.1.61591 WP_000721553.1.6168 WP_000721553.1.61784 WP_000721553.1.61910 WP_000721553.1.61970 WP_000721553.1.62030 WP_000721553.1.62093 WP_000721553.1.62140 WP_000721553.1.62164 WP_000721553.1.62367 WP_000721553.1.62409 WP_000721553.1.62459 WP_000721553.1.62537 WP_000721553.1.62539 WP_000721553.1.62575 WP_000721553.1.62625 WP_000721553.1.62685 WP_000721553.1.62740 WP_000721553.1.62756 WP_000721553.1.62781 WP_000721553.1.62796 WP_000721553.1.62808 WP_000721553.1.62829 WP_000721553.1.62842 WP_000721553.1.62878 WP_000721553.1.62956 WP_000721553.1.63011 WP_000721553.1.63050 WP_000721553.1.63068 WP_000721553.1.631 WP_000721553.1.63132 WP_000721553.1.63182 WP_000721553.1.63195 WP_000721553.1.63215 WP_000721553.1.63233 WP_000721553.1.63244 WP_000721553.1.63273 WP_000721553.1.63279 WP_000721553.1.63296 WP_000721553.1.63307 WP_000721553.1.63319 WP_000721553.1.63324 WP_000721553.1.63335 WP_000721553.1.63337 WP_000721553.1.63383 WP_000721553.1.634 WP_000721553.1.63406 WP_000721553.1.63411 WP_000721553.1.63421 WP_000721553.1.63460 WP_000721553.1.63510 WP_000721553.1.63527 WP_000721553.1.63565 WP_000721553.1.63617 WP_000721553.1.63693 WP_000721553.1.63705 WP_000721553.1.6378 WP_000721553.1.63847 WP_000721553.1.63894 WP_000721553.1.64012 WP_000721553.1.64094 WP_000721553.1.64108 WP_000721553.1.64207 WP_000721553.1.64251 WP_000721553.1.64303 WP_000721553.1.64368 WP_000721553.1.64628 WP_000721553.1.64643 WP_000721553.1.64665 WP_000721553.1.64811 WP_000721553.1.64845 WP_000721553.1.64860 WP_000721553.1.64951 WP_000721553.1.64956 WP_000721553.1.64996 WP_000721553.1.64998 WP_000721553.1.65025 WP_000721553.1.65038 WP_000721553.1.65076 WP_000721553.1.65264 WP_000721553.1.65358 WP_000721553.1.65387 WP_000721553.1.65406 WP_000721553.1.65407 WP_000721553.1.6544 WP_000721553.1.65448 WP_000721553.1.65585 WP_000721553.1.65616 WP_000721553.1.65629 WP_000721553.1.65643 WP_000721553.1.65656 WP_000721553.1.6568 WP_000721553.1.65713 WP_000721553.1.65734 WP_000721553.1.65769 WP_000721553.1.65809 WP_000721553.1.6585 WP_000721553.1.65892 WP_000721553.1.65935 WP_000721553.1.65947 WP_000721553.1.65948 WP_000721553.1.65965 WP_000721553.1.6603 WP_000721553.1.66054 WP_000721553.1.66069 WP_000721553.1.66073 WP_000721553.1.66130 WP_000721553.1.66144 WP_000721553.1.66265 WP_000721553.1.66298 WP_000721553.1.6632 WP_000721553.1.66366 WP_000721553.1.66453 WP_000721553.1.66513 WP_000721553.1.66556 WP_000721553.1.66598 WP_000721553.1.66611 WP_000721553.1.66614 WP_000721553.1.66705 WP_000721553.1.66756 WP_000721553.1.66766 WP_000721553.1.66803 WP_000721553.1.66816 WP_000721553.1.6688 WP_000721553.1.66938 WP_000721553.1.66969 WP_000721553.1.67012 WP_000721553.1.67014 WP_000721553.1.67067 WP_000721553.1.67072 WP_000721553.1.67113 WP_000721553.1.67155 WP_000721553.1.67160 WP_000721553.1.67238 WP_000721553.1.67251 WP_000721553.1.67259 WP_000721553.1.6726 WP_000721553.1.67286 WP_000721553.1.67294 WP_000721553.1.67312 WP_000721553.1.67328 WP_000721553.1.67418 WP_000721553.1.67420 WP_000721553.1.67425 WP_000721553.1.67457 WP_000721553.1.67460 WP_000721553.1.67540 WP_000721553.1.67571 WP_000721553.1.67621 WP_000721553.1.67644 WP_000721553.1.67653 WP_000721553.1.67691 WP_000721553.1.67806 WP_000721553.1.67834 WP_000721553.1.67867 WP_000721553.1.67880 WP_000721553.1.67900 WP_000721553.1.67991 WP_000721553.1.68101 WP_000721553.1.68134 WP_000721553.1.68141 WP_000721553.1.68152 WP_000721553.1.68202 WP_000721553.1.68221 WP_000721553.1.68223 WP_000721553.1.6824 WP_000721553.1.68268 WP_000721553.1.68299 WP_000721553.1.68355 WP_000721553.1.68366 WP_000721553.1.68398 WP_000721553.1.68399 WP_000721553.1.68476 WP_000721553.1.68479 WP_000721553.1.68504 WP_000721553.1.68512 WP_000721553.1.68548 WP_000721553.1.686 WP_000721553.1.68681 WP_000721553.1.68683 WP_000721553.1.68741 WP_000721553.1.68743 WP_000721553.1.68883 WP_000721553.1.68998 WP_000721553.1.69012 WP_000721553.1.69071 WP_000721553.1.69078 WP_000721553.1.69105 WP_000721553.1.69147 WP_000721553.1.6915 WP_000721553.1.69198 WP_000721553.1.69213 WP_000721553.1.69349 WP_000721553.1.69394 WP_000721553.1.69437 WP_000721553.1.69475 WP_000721553.1.69490 WP_000721553.1.69546 WP_000721553.1.69598 WP_000721553.1.6968 WP_000721553.1.69683 WP_000721553.1.69724 WP_000721553.1.69734 WP_000721553.1.6980 WP_000721553.1.69820 WP_000721553.1.69823 WP_000721553.1.69830 WP_000721553.1.69882 WP_000721553.1.699 WP_000721553.1.69902 WP_000721553.1.69934 WP_000721553.1.69980 WP_000721553.1.69995 WP_000721553.1.70059 WP_000721553.1.70161 WP_000721553.1.70220 WP_000721553.1.70225 WP_000721553.1.70228 WP_000721553.1.70294 WP_000721553.1.70311 WP_000721553.1.70313 WP_000721553.1.70334 WP_000721553.1.70448 WP_000721553.1.7046 WP_000721553.1.70487 WP_000721553.1.70495 WP_000721553.1.70527 WP_000721553.1.70554 WP_000721553.1.70558 WP_000721553.1.70564 WP_000721553.1.7064 WP_000721553.1.70664 WP_000721553.1.707 WP_000721553.1.70721 WP_000721553.1.70763 WP_000721553.1.70808 WP_000721553.1.70835 WP_000721553.1.70843 WP_000721553.1.70909 WP_000721553.1.70926 WP_000721553.1.710 WP_000721553.1.71016 WP_000721553.1.7105 WP_000721553.1.71208 WP_000721553.1.71231 WP_000721553.1.71267 WP_000721553.1.71313 WP_000721553.1.71410 WP_000721553.1.71467 WP_000721553.1.71475 WP_000721553.1.71715 WP_000721553.1.71721 WP_000721553.1.71737 WP_000721553.1.71739 WP_000721553.1.71741 WP_000721553.1.71863 WP_000721553.1.71877 WP_000721553.1.71892 WP_000721553.1.71899 WP_000721553.1.71910 WP_000721553.1.71978 WP_000721553.1.72002 WP_000721553.1.72018 WP_000721553.1.72085 WP_000721553.1.72148 WP_000721553.1.722 WP_000721553.1.72306 WP_000721553.1.72340 WP_000721553.1.72363 WP_000721553.1.72371 WP_000721553.1.72453 WP_000721553.1.72465 WP_000721553.1.72497 WP_000721553.1.7254 WP_000721553.1.7258 WP_000721553.1.7260 WP_000721553.1.72626 WP_000721553.1.72649 WP_000721553.1.72666 WP_000721553.1.72708 WP_000721553.1.72719 WP_000721553.1.72750 WP_000721553.1.72753 WP_000721553.1.72762 WP_000721553.1.72881 WP_000721553.1.72930 WP_000721553.1.72961 WP_000721553.1.72991 WP_000721553.1.73002 WP_000721553.1.73021 WP_000721553.1.73087 WP_000721553.1.73140 WP_000721553.1.73190 WP_000721553.1.73195 WP_000721553.1.73201 WP_000721553.1.73211 WP_000721553.1.73240 WP_000721553.1.73241 WP_000721553.1.73264 WP_000721553.1.73401 WP_000721553.1.73420 WP_000721553.1.73450 WP_000721553.1.73464 WP_000721553.1.73513 WP_000721553.1.73539 WP_000721553.1.7360 WP_000721553.1.73610 WP_000721553.1.7365 WP_000721553.1.73674 WP_000721553.1.73694 WP_000721553.1.73740 WP_000721553.1.73789 WP_000721553.1.73885 WP_000721553.1.73900 WP_000721553.1.73921 WP_000721553.1.73949 WP_000721553.1.73971 WP_000721553.1.74004 WP_000721553.1.7401 WP_000721553.1.7406 WP_000721553.1.74073 WP_000721553.1.74085 WP_000721553.1.74257 WP_000721553.1.74284 WP_000721553.1.74295 WP_000721553.1.74327 WP_000721553.1.74456 WP_000721553.1.74468 WP_000721553.1.74576 WP_000721553.1.74676 WP_000721553.1.74681 WP_000721553.1.74758 WP_000721553.1.74770 WP_000721553.1.74785 WP_000721553.1.74797 WP_000721553.1.7482 WP_000721553.1.74846 WP_000721553.1.74874 WP_000721553.1.75070 WP_000721553.1.75111 WP_000721553.1.75131 WP_000721553.1.75132 WP_000721553.1.75323 WP_000721553.1.75351 WP_000721553.1.75356 WP_000721553.1.75409 WP_000721553.1.75538 WP_000721553.1.75566 WP_000721553.1.75571 WP_000721553.1.75647 WP_000721553.1.75692 WP_000721553.1.75728 WP_000721553.1.75743 WP_000721553.1.75800 WP_000721553.1.75809 WP_000721553.1.75840 WP_000721553.1.75862 WP_000721553.1.75910 WP_000721553.1.76013 WP_000721553.1.7602 WP_000721553.1.76047 WP_000721553.1.76049 WP_000721553.1.76050 WP_000721553.1.76053 WP_000721553.1.76111 WP_000721553.1.76121 WP_000721553.1.76153 WP_000721553.1.76179 WP_000721553.1.7627 WP_000721553.1.76282 WP_000721553.1.76313 WP_000721553.1.76424 WP_000721553.1.76426 WP_000721553.1.76431 WP_000721553.1.76463 WP_000721553.1.76497 WP_000721553.1.765 WP_000721553.1.76674 WP_000721553.1.76711 WP_000721553.1.76718 WP_000721553.1.76798 WP_000721553.1.76803 WP_000721553.1.76829 WP_000721553.1.7694 WP_000721553.1.77043 WP_000721553.1.77072 WP_000721553.1.77137 WP_000721553.1.77158 WP_000721553.1.77187 WP_000721553.1.77190 WP_000721553.1.77203 WP_000721553.1.77229 WP_000721553.1.77297 WP_000721553.1.77298 WP_000721553.1.77331 WP_000721553.1.77346 WP_000721553.1.77359 WP_000721553.1.77388 WP_000721553.1.77498 WP_000721553.1.77532 WP_000721553.1.77650 WP_000721553.1.77735 WP_000721553.1.77791 WP_000721553.1.7785 WP_000721553.1.7786 WP_000721553.1.77882 WP_000721553.1.77893 WP_000721553.1.77915 WP_000721553.1.77922 WP_000721553.1.77930 WP_000721553.1.77952 WP_000721553.1.77986 WP_000721553.1.78038 WP_000721553.1.78082 WP_000721553.1.78093 WP_000721553.1.78095 WP_000721553.1.78164 WP_000721553.1.78179 WP_000721553.1.78194 WP_000721553.1.78304 WP_000721553.1.78330 WP_000721553.1.78335 WP_000721553.1.78371 WP_000721553.1.78434 WP_000721553.1.78436 WP_000721553.1.78470 WP_000721553.1.78489 WP_000721553.1.78494 WP_000721553.1.7853 WP_000721553.1.78573 WP_000721553.1.78585 WP_000721553.1.78592 WP_000721553.1.78662 WP_000721553.1.78685 WP_000721553.1.78736 WP_000721553.1.78758 WP_000721553.1.78763 WP_000721553.1.78816 WP_000721553.1.78920 WP_000721553.1.78937 WP_000721553.1.78991 WP_000721553.1.78995 WP_000721553.1.7905 WP_000721553.1.79110 WP_000721553.1.7914 WP_000721553.1.79143 WP_000721553.1.79178 WP_000721553.1.79192 WP_000721553.1.79227 WP_000721553.1.79275 WP_000721553.1.79285 WP_000721553.1.79378 WP_000721553.1.79408 WP_000721553.1.79552 WP_000721553.1.79581 WP_000721553.1.79627 WP_000721553.1.79676 WP_000721553.1.79677 WP_000721553.1.79731 WP_000721553.1.79763 WP_000721553.1.7981 WP_000721553.1.79815 WP_000721553.1.79904 WP_000721553.1.79949 WP_000721553.1.80009 WP_000721553.1.80013 WP_000721553.1.80029 WP_000721553.1.80086 WP_000721553.1.80119 WP_000721553.1.80120 WP_000721553.1.80122 WP_000721553.1.80146 WP_000721553.1.80178 WP_000721553.1.80184 WP_000721553.1.80210 WP_000721553.1.80244 WP_000721553.1.80274 WP_000721553.1.80316 WP_000721553.1.80361 WP_000721553.1.80389 WP_000721553.1.8040 WP_000721553.1.80434 WP_000721553.1.8045 WP_000721553.1.80521 WP_000721553.1.80582 WP_000721553.1.80653 WP_000721553.1.80745 WP_000721553.1.80899 WP_000721553.1.81022 WP_000721553.1.81049 WP_000721553.1.81052 WP_000721553.1.81064 WP_000721553.1.81095 WP_000721553.1.81132 WP_000721553.1.81151 WP_000721553.1.81172 WP_000721553.1.81176 WP_000721553.1.81184 WP_000721553.1.81214 WP_000721553.1.81228 WP_000721553.1.81232 WP_000721553.1.81288 WP_000721553.1.81290 WP_000721553.1.81379 WP_000721553.1.81508 WP_000721553.1.81574 WP_000721553.1.8160 WP_000721553.1.81604 WP_000721553.1.81619 WP_000721553.1.81645 WP_000721553.1.8180 WP_000721553.1.81837 WP_000721553.1.81838 WP_000721553.1.8185 WP_000721553.1.81969 WP_000721553.1.81990 WP_000721553.1.8206 WP_000721553.1.82103 WP_000721553.1.8213 WP_000721553.1.82174 WP_000721553.1.82184 WP_000721553.1.82253 WP_000721553.1.82278 WP_000721553.1.82281 WP_000721553.1.82301 WP_000721553.1.82349 WP_000721553.1.82406 WP_000721553.1.82458 WP_000721553.1.82468 WP_000721553.1.82525 WP_000721553.1.82535 WP_000721553.1.82558 WP_000721553.1.8266 WP_000721553.1.82678 WP_000721553.1.82768 WP_000721553.1.82824 WP_000721553.1.82855 WP_000721553.1.82930 WP_000721553.1.82941 WP_000721553.1.83046 WP_000721553.1.83054 WP_000721553.1.83078 WP_000721553.1.83086 WP_000721553.1.83103 WP_000721553.1.8318 WP_000721553.1.83203 WP_000721553.1.83291 WP_000721553.1.83359 WP_000721553.1.83405 WP_000721553.1.83417 WP_000721553.1.8346 WP_000721553.1.83467 WP_000721553.1.83472 WP_000721553.1.83479 WP_000721553.1.83520 WP_000721553.1.83553 WP_000721553.1.8366 WP_000721553.1.83674 WP_000721553.1.83728 WP_000721553.1.83750 WP_000721553.1.83758 WP_000721553.1.83788 WP_000721553.1.83797 WP_000721553.1.83844 WP_000721553.1.8385 WP_000721553.1.83886 WP_000721553.1.83989 WP_000721553.1.84025 WP_000721553.1.84054 WP_000721553.1.84118 WP_000721553.1.84129 WP_000721553.1.84161 WP_000721553.1.84188 WP_000721553.1.84275 WP_000721553.1.84415 WP_000721553.1.84418 WP_000721553.1.84508 WP_000721553.1.84590 WP_000721553.1.84608 WP_000721553.1.8462 WP_000721553.1.84648 WP_000721553.1.84651 WP_000721553.1.84696 WP_000721553.1.84826 WP_000721553.1.84847 WP_000721553.1.84854 WP_000721553.1.84924 WP_000721553.1.8496 WP_000721553.1.84975 WP_000721553.1.84978 WP_000721553.1.85017 WP_000721553.1.85026 WP_000721553.1.85045 WP_000721553.1.85070 WP_000721553.1.85118 WP_000721553.1.85229 WP_000721553.1.85289 WP_000721553.1.85302 WP_000721553.1.85375 WP_000721553.1.85376 WP_000721553.1.85409 WP_000721553.1.85441 WP_000721553.1.85485 WP_000721553.1.85585 WP_000721553.1.85611 WP_000721553.1.85730 WP_000721553.1.85732 WP_000721553.1.85858 WP_000721553.1.85906 WP_000721553.1.85924 WP_000721553.1.85971 WP_000721553.1.85980 WP_000721553.1.86036 WP_000721553.1.86042 WP_000721553.1.86086 WP_000721553.1.862 WP_000721553.1.86209 WP_000721553.1.86281 WP_000721553.1.86315 WP_000721553.1.8636 WP_000721553.1.86363 WP_000721553.1.86390 WP_000721553.1.86473 WP_000721553.1.86531 WP_000721553.1.86664 WP_000721553.1.86704 WP_000721553.1.86736 WP_000721553.1.86745 WP_000721553.1.86779 WP_000721553.1.86793 WP_000721553.1.86795 WP_000721553.1.8690 WP_000721553.1.86968 WP_000721553.1.86999 WP_000721553.1.87088 WP_000721553.1.87097 WP_000721553.1.87100 WP_000721553.1.87133 WP_000721553.1.87137 WP_000721553.1.87168 WP_000721553.1.87190 WP_000721553.1.87204 WP_000721553.1.87221 WP_000721553.1.87296 WP_000721553.1.87363 WP_000721553.1.87372 WP_000721553.1.87388 WP_000721553.1.87486 WP_000721553.1.87511 WP_000721553.1.87541 WP_000721553.1.87595 WP_000721553.1.8764 WP_000721553.1.87734 WP_000721553.1.87745 WP_000721553.1.87841 WP_000721553.1.87854 WP_000721553.1.87865 WP_000721553.1.87937 WP_000721553.1.87967 WP_000721553.1.88169 WP_000721553.1.88309 WP_000721553.1.88373 WP_000721553.1.88375 WP_000721553.1.88418 WP_000721553.1.88430 WP_000721553.1.88440 WP_000721553.1.88449 WP_000721553.1.8847 WP_000721553.1.88560 WP_000721553.1.88563 WP_000721553.1.88585 WP_000721553.1.8859 WP_000721553.1.88600 WP_000721553.1.88614 WP_000721553.1.88696 WP_000721553.1.88771 WP_000721553.1.88781 WP_000721553.1.88843 WP_000721553.1.88878 WP_000721553.1.88954 WP_000721553.1.88960 WP_000721553.1.88962 WP_000721553.1.89012 WP_000721553.1.89024 WP_000721553.1.89036 WP_000721553.1.89125 WP_000721553.1.89164 WP_000721553.1.8918 WP_000721553.1.89184 WP_000721553.1.89262 WP_000721553.1.89290 WP_000721553.1.89348 WP_000721553.1.89350 WP_000721553.1.89390 WP_000721553.1.89404 WP_000721553.1.89433 WP_000721553.1.897 WP_000721553.1.89779 WP_000721553.1.89794 WP_000721553.1.898 WP_000721553.1.89863 WP_000721553.1.89908 WP_000721553.1.89949 WP_000721553.1.89950 WP_000721553.1.90069 WP_000721553.1.90173 WP_000721553.1.90174 WP_000721553.1.90217 WP_000721553.1.90246 WP_000721553.1.90250 WP_000721553.1.90386 WP_000721553.1.90447 WP_000721553.1.90454 WP_000721553.1.90475 WP_000721553.1.90488 WP_000721553.1.90506 WP_000721553.1.90517 WP_000721553.1.90533 WP_000721553.1.90556 WP_000721553.1.90661 WP_000721553.1.90698 WP_000721553.1.9076 WP_000721553.1.91005 WP_000721553.1.91019 WP_000721553.1.91150 WP_000721553.1.9122 WP_000721553.1.91280 WP_000721553.1.91287 WP_000721553.1.91371 WP_000721553.1.91447 WP_000721553.1.91486 WP_000721553.1.91525 WP_000721553.1.91530 WP_000721553.1.9155 WP_000721553.1.91586 WP_000721553.1.91611 WP_000721553.1.91634 WP_000721553.1.91670 WP_000721553.1.917 WP_000721553.1.91704 WP_000721553.1.91745 WP_000721553.1.91848 WP_000721553.1.91918 WP_000721553.1.91969 WP_000721553.1.92125 WP_000721553.1.92186 WP_000721553.1.92212 WP_000721553.1.92228 WP_000721553.1.92244 WP_000721553.1.92249 WP_000721553.1.92303 WP_000721553.1.92391 WP_000721553.1.92405 WP_000721553.1.92425 WP_000721553.1.9247 WP_000721553.1.92512 WP_000721553.1.92667 WP_000721553.1.92674 WP_000721553.1.92718 WP_000721553.1.92765 WP_000721553.1.9286 WP_000721553.1.9296 WP_000721553.1.92965 WP_000721553.1.92997 WP_000721553.1.93047 WP_000721553.1.93071 WP_000721553.1.93147 WP_000721553.1.93197 WP_000721553.1.93237 WP_000721553.1.93243 WP_000721553.1.93254 WP_000721553.1.93260 WP_000721553.1.93378 WP_000721553.1.93471 WP_000721553.1.93567 WP_000721553.1.93579 WP_000721553.1.93708 WP_000721553.1.93758 WP_000721553.1.93762 WP_000721553.1.93775 WP_000721553.1.93890 WP_000721553.1.94 WP_000721553.1.94053 WP_000721553.1.94080 WP_000721553.1.9411 WP_000721553.1.94122 WP_000721553.1.94123 WP_000721553.1.94130 WP_000721553.1.94242 WP_000721553.1.94245 WP_000721553.1.94248 WP_000721553.1.94268 WP_000721553.1.94287 WP_000721553.1.9430 WP_000721553.1.94320 WP_000721553.1.94324 WP_000721553.1.94337 WP_000721553.1.94341 WP_000721553.1.94484 WP_000721553.1.94536 WP_000721553.1.9455 WP_000721553.1.947 WP_000721553.1.94825 WP_000721553.1.94969 WP_000721553.1.95008 WP_000721553.1.95023 WP_000721553.1.95029 WP_000721553.1.95033 WP_000721553.1.95156 WP_000721553.1.95193 WP_000721553.1.95210 WP_000721553.1.95263 WP_000721553.1.95281 WP_000721553.1.95294 WP_000721553.1.95386 WP_000721553.1.95415 WP_000721553.1.95494 WP_000721553.1.95512 WP_000721553.1.95519 WP_000721553.1.95522 WP_000721553.1.95560 WP_000721553.1.9563 WP_000721553.1.95683 WP_000721553.1.95780 WP_000721553.1.95804 WP_000721553.1.95832 WP_000721553.1.959 WP_000721553.1.95962 WP_000721553.1.96160 WP_000721553.1.96163 WP_000721553.1.96209 WP_000721553.1.96218 WP_000721553.1.96271 WP_000721553.1.96305 WP_000721553.1.96316 WP_000721553.1.96468 WP_000721553.1.96568 WP_000721553.1.96634 WP_000721553.1.96646 WP_000721553.1.96654 WP_000721553.1.96688 WP_000721553.1.96727 WP_000721553.1.96770 WP_000721553.1.96804 WP_000721553.1.96882 WP_000721553.1.96895 WP_000721553.1.96918 WP_000721553.1.9695 WP_000721553.1.96976 WP_000721553.1.97001 WP_000721553.1.97007 WP_000721553.1.97019 WP_000721553.1.97072 WP_000721553.1.97117 WP_000721553.1.97138 WP_000721553.1.97191 WP_000721553.1.97267 WP_000721553.1.97295 WP_000721553.1.97411 WP_000721553.1.97536 WP_000721553.1.97574 WP_000721553.1.97627 WP_000721553.1.97731 WP_000721553.1.97739 WP_000721553.1.97758 WP_000721553.1.97786 WP_000721553.1.97827 WP_000721553.1.97835 WP_000721553.1.9789 WP_000721553.1.97899 WP_000721553.1.97928 WP_000721553.1.97999 WP_000721553.1.98011 WP_000721553.1.98033 WP_000721553.1.98051 WP_000721553.1.98242 WP_000721553.1.98361 WP_000721553.1.98379 WP_000721553.1.98411 WP_000721553.1.98456 WP_000721553.1.98512 WP_000721553.1.98552 WP_000721553.1.986 WP_000721553.1.98655 WP_000721553.1.98706 WP_000721553.1.98767 WP_000721553.1.98837 WP_000721553.1.98858 WP_000721553.1.98874 WP_000721553.1.98967 WP_000721553.1.99009 WP_000721553.1.99025 WP_000721553.1.9912 WP_000721553.1.99155 WP_000721553.1.99171 WP_000721553.1.99249 WP_000721553.1.99280 WP_000721553.1.99359 WP_000721553.1.9936 WP_000721553.1.99405 WP_000721553.1.99430 WP_000721553.1.99459 WP_000721553.1.99492 WP_000721553.1.99494 WP_000721553.1.99519 WP_000721553.1.99536 WP_000721553.1.99538 WP_000721553.1.99564 WP_000721553.1.99569 WP_000721553.1.9960 WP_000721553.1.99631 WP_000721553.1.99638 WP_000721553.1.99759 WP_000721553.1.99802 WP_000721553.1.99850 WP_000721553.1.99860 WP_000721553.1.9987 WP_000721553.1.99926 WP_000721553.1.99956 WP_000721553.1.99979 WP_000721553.1.99985 YP_501203.1.76163 426430.NWMN_2345 451515.SAUSA300_2391 451516.USA300HOU_2435 93061.SAOUHSC_02742 93062.SACOL2451 gi|87161518|ref|YP_495026.1| gi|88196380|ref|YP_501203.1| gi|151222557|ref|YP_001333379.1| gi|554645343|ref|YP_008717134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]