SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|521213439|ref|YP_008169785.1| from Staphylococcus aureus Bmb9393

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521213439|ref|YP_008169785.1|
Domain Number 1 Region: 1-198
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.52e-57
Family Phosphate binding protein-like 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|521213439|ref|YP_008169785.1|
Sequence length 204
Comment ATP phosphoribosyltransferase [Staphylococcus aureus Bmb9393]
Sequence
MLRIAIAKGRLMDSLINYLDAIEFTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVE
QGIADIGIVGSDILDERHYNVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYF
KSKGIDVELIKLNGSVELACVVDMVDGIVDIVQTGTTLKANGLVEKQHISDINARLITNK
AAYFKKSQLIEQFIRSLEVSIANA
Download sequence
Identical sequences A0A0E1AQB1 A0A0E1XD11 A0A131K239 Q6GDC5
gi|384863325|ref|YP_005746045.1| WP_000944135.1.100090 WP_000944135.1.100352 WP_000944135.1.101458 WP_000944135.1.101757 WP_000944135.1.101758 WP_000944135.1.101775 WP_000944135.1.10408 WP_000944135.1.10486 WP_000944135.1.10969 WP_000944135.1.1136 WP_000944135.1.11894 WP_000944135.1.12158 WP_000944135.1.12179 WP_000944135.1.12226 WP_000944135.1.1253 WP_000944135.1.12555 WP_000944135.1.13307 WP_000944135.1.13505 WP_000944135.1.1355 WP_000944135.1.13709 WP_000944135.1.13726 WP_000944135.1.13807 WP_000944135.1.14221 WP_000944135.1.14272 WP_000944135.1.14314 WP_000944135.1.14365 WP_000944135.1.15228 WP_000944135.1.15641 WP_000944135.1.15712 WP_000944135.1.16026 WP_000944135.1.16083 WP_000944135.1.16214 WP_000944135.1.16408 WP_000944135.1.16414 WP_000944135.1.16564 WP_000944135.1.1666 WP_000944135.1.16679 WP_000944135.1.16757 WP_000944135.1.16802 WP_000944135.1.17520 WP_000944135.1.17524 WP_000944135.1.17650 WP_000944135.1.1811 WP_000944135.1.18132 WP_000944135.1.18197 WP_000944135.1.1849 WP_000944135.1.18526 WP_000944135.1.18538 WP_000944135.1.18605 WP_000944135.1.18627 WP_000944135.1.18799 WP_000944135.1.18870 WP_000944135.1.1912 WP_000944135.1.19370 WP_000944135.1.19390 WP_000944135.1.19807 WP_000944135.1.19853 WP_000944135.1.19928 WP_000944135.1.20201 WP_000944135.1.20307 WP_000944135.1.20354 WP_000944135.1.20496 WP_000944135.1.2079 WP_000944135.1.21081 WP_000944135.1.21919 WP_000944135.1.22332 WP_000944135.1.22351 WP_000944135.1.22512 WP_000944135.1.23489 WP_000944135.1.2365 WP_000944135.1.24347 WP_000944135.1.24388 WP_000944135.1.24502 WP_000944135.1.24597 WP_000944135.1.24644 WP_000944135.1.24780 WP_000944135.1.24817 WP_000944135.1.24856 WP_000944135.1.25187 WP_000944135.1.25495 WP_000944135.1.25591 WP_000944135.1.25597 WP_000944135.1.25744 WP_000944135.1.25867 WP_000944135.1.26650 WP_000944135.1.26886 WP_000944135.1.27042 WP_000944135.1.27097 WP_000944135.1.27120 WP_000944135.1.27127 WP_000944135.1.27622 WP_000944135.1.27662 WP_000944135.1.27673 WP_000944135.1.2768 WP_000944135.1.27717 WP_000944135.1.27999 WP_000944135.1.28025 WP_000944135.1.28298 WP_000944135.1.28388 WP_000944135.1.28477 WP_000944135.1.28691 WP_000944135.1.28725 WP_000944135.1.29170 WP_000944135.1.29250 WP_000944135.1.30150 WP_000944135.1.30154 WP_000944135.1.30188 WP_000944135.1.30294 WP_000944135.1.30690 WP_000944135.1.30768 WP_000944135.1.30779 WP_000944135.1.30861 WP_000944135.1.30945 WP_000944135.1.31114 WP_000944135.1.31363 WP_000944135.1.31990 WP_000944135.1.32106 WP_000944135.1.32269 WP_000944135.1.32454 WP_000944135.1.32898 WP_000944135.1.33277 WP_000944135.1.33372 WP_000944135.1.33394 WP_000944135.1.33426 WP_000944135.1.3358 WP_000944135.1.33737 WP_000944135.1.34307 WP_000944135.1.34438 WP_000944135.1.34578 WP_000944135.1.34847 WP_000944135.1.34877 WP_000944135.1.35264 WP_000944135.1.35345 WP_000944135.1.35837 WP_000944135.1.35933 WP_000944135.1.36814 WP_000944135.1.36820 WP_000944135.1.37336 WP_000944135.1.37343 WP_000944135.1.37546 WP_000944135.1.38491 WP_000944135.1.38651 WP_000944135.1.38669 WP_000944135.1.39080 WP_000944135.1.39330 WP_000944135.1.39347 WP_000944135.1.39642 WP_000944135.1.39847 WP_000944135.1.39883 WP_000944135.1.40119 WP_000944135.1.40443 WP_000944135.1.40458 WP_000944135.1.41341 WP_000944135.1.41456 WP_000944135.1.41698 WP_000944135.1.41821 WP_000944135.1.41954 WP_000944135.1.4202 WP_000944135.1.42344 WP_000944135.1.42788 WP_000944135.1.42924 WP_000944135.1.43220 WP_000944135.1.4369 WP_000944135.1.4379 WP_000944135.1.44021 WP_000944135.1.44150 WP_000944135.1.44178 WP_000944135.1.44255 WP_000944135.1.44480 WP_000944135.1.44655 WP_000944135.1.44940 WP_000944135.1.44948 WP_000944135.1.45303 WP_000944135.1.45447 WP_000944135.1.4545 WP_000944135.1.45972 WP_000944135.1.46488 WP_000944135.1.46576 WP_000944135.1.46696 WP_000944135.1.47308 WP_000944135.1.47530 WP_000944135.1.47667 WP_000944135.1.48017 WP_000944135.1.48064 WP_000944135.1.48338 WP_000944135.1.48664 WP_000944135.1.48996 WP_000944135.1.4920 WP_000944135.1.49227 WP_000944135.1.4924 WP_000944135.1.49362 WP_000944135.1.49825 WP_000944135.1.50071 WP_000944135.1.50178 WP_000944135.1.50711 WP_000944135.1.50745 WP_000944135.1.5080 WP_000944135.1.51271 WP_000944135.1.51558 WP_000944135.1.51741 WP_000944135.1.51973 WP_000944135.1.52754 WP_000944135.1.52836 WP_000944135.1.52893 WP_000944135.1.53189 WP_000944135.1.53285 WP_000944135.1.5347 WP_000944135.1.53532 WP_000944135.1.5359 WP_000944135.1.53886 WP_000944135.1.54029 WP_000944135.1.54048 WP_000944135.1.54105 WP_000944135.1.54246 WP_000944135.1.54290 WP_000944135.1.54830 WP_000944135.1.54851 WP_000944135.1.54895 WP_000944135.1.54929 WP_000944135.1.5606 WP_000944135.1.56159 WP_000944135.1.56265 WP_000944135.1.56306 WP_000944135.1.56737 WP_000944135.1.56779 WP_000944135.1.56803 WP_000944135.1.57102 WP_000944135.1.57614 WP_000944135.1.57883 WP_000944135.1.58042 WP_000944135.1.58106 WP_000944135.1.58185 WP_000944135.1.58242 WP_000944135.1.5832 WP_000944135.1.58481 WP_000944135.1.58603 WP_000944135.1.58839 WP_000944135.1.59175 WP_000944135.1.5930 WP_000944135.1.59567 WP_000944135.1.59810 WP_000944135.1.60165 WP_000944135.1.602 WP_000944135.1.60289 WP_000944135.1.6045 WP_000944135.1.60704 WP_000944135.1.61413 WP_000944135.1.61534 WP_000944135.1.61899 WP_000944135.1.62416 WP_000944135.1.62756 WP_000944135.1.62781 WP_000944135.1.63047 WP_000944135.1.63051 WP_000944135.1.63120 WP_000944135.1.63143 WP_000944135.1.63190 WP_000944135.1.63228 WP_000944135.1.63233 WP_000944135.1.63383 WP_000944135.1.63923 WP_000944135.1.642 WP_000944135.1.64396 WP_000944135.1.64628 WP_000944135.1.64643 WP_000944135.1.64956 WP_000944135.1.65264 WP_000944135.1.65346 WP_000944135.1.65358 WP_000944135.1.65512 WP_000944135.1.6559 WP_000944135.1.65879 WP_000944135.1.65930 WP_000944135.1.65946 WP_000944135.1.65986 WP_000944135.1.66482 WP_000944135.1.66628 WP_000944135.1.66765 WP_000944135.1.66996 WP_000944135.1.67063 WP_000944135.1.67147 WP_000944135.1.67212 WP_000944135.1.67864 WP_000944135.1.68466 WP_000944135.1.68512 WP_000944135.1.68716 WP_000944135.1.68878 WP_000944135.1.68987 WP_000944135.1.68988 WP_000944135.1.69266 WP_000944135.1.69409 WP_000944135.1.69490 WP_000944135.1.69734 WP_000944135.1.70059 WP_000944135.1.70094 WP_000944135.1.70413 WP_000944135.1.70441 WP_000944135.1.706 WP_000944135.1.70664 WP_000944135.1.7119 WP_000944135.1.71316 WP_000944135.1.7164 WP_000944135.1.71707 WP_000944135.1.71863 WP_000944135.1.71899 WP_000944135.1.72102 WP_000944135.1.722 WP_000944135.1.72204 WP_000944135.1.72285 WP_000944135.1.72340 WP_000944135.1.72453 WP_000944135.1.72496 WP_000944135.1.7254 WP_000944135.1.72930 WP_000944135.1.73002 WP_000944135.1.73046 WP_000944135.1.73121 WP_000944135.1.7326 WP_000944135.1.7360 WP_000944135.1.73853 WP_000944135.1.74138 WP_000944135.1.74221 WP_000944135.1.74497 WP_000944135.1.74510 WP_000944135.1.74590 WP_000944135.1.74775 WP_000944135.1.74808 WP_000944135.1.75304 WP_000944135.1.75800 WP_000944135.1.7627 WP_000944135.1.76295 WP_000944135.1.76674 WP_000944135.1.76872 WP_000944135.1.76876 WP_000944135.1.77069 WP_000944135.1.77158 WP_000944135.1.77187 WP_000944135.1.77893 WP_000944135.1.78067 WP_000944135.1.78093 WP_000944135.1.78116 WP_000944135.1.78210 WP_000944135.1.78335 WP_000944135.1.78478 WP_000944135.1.78662 WP_000944135.1.78758 WP_000944135.1.79132 WP_000944135.1.7930 WP_000944135.1.79407 WP_000944135.1.79554 WP_000944135.1.79566 WP_000944135.1.79581 WP_000944135.1.80193 WP_000944135.1.80308 WP_000944135.1.80345 WP_000944135.1.80361 WP_000944135.1.80430 WP_000944135.1.81290 WP_000944135.1.81522 WP_000944135.1.81651 WP_000944135.1.81837 WP_000944135.1.81847 WP_000944135.1.82026 WP_000944135.1.82058 WP_000944135.1.82100 WP_000944135.1.82321 WP_000944135.1.82472 WP_000944135.1.82535 WP_000944135.1.82665 WP_000944135.1.82999 WP_000944135.1.83086 WP_000944135.1.83314 WP_000944135.1.83541 WP_000944135.1.8385 WP_000944135.1.83980 WP_000944135.1.84651 WP_000944135.1.84700 WP_000944135.1.84770 WP_000944135.1.85118 WP_000944135.1.85173 WP_000944135.1.85585 WP_000944135.1.85825 WP_000944135.1.862 WP_000944135.1.86241 WP_000944135.1.8636 WP_000944135.1.86390 WP_000944135.1.86473 WP_000944135.1.86779 WP_000944135.1.8699 WP_000944135.1.87096 WP_000944135.1.87110 WP_000944135.1.87204 WP_000944135.1.87497 WP_000944135.1.8757 WP_000944135.1.87579 WP_000944135.1.87647 WP_000944135.1.87735 WP_000944135.1.87985 WP_000944135.1.88101 WP_000944135.1.88455 WP_000944135.1.88478 WP_000944135.1.88738 WP_000944135.1.88805 WP_000944135.1.88959 WP_000944135.1.88960 WP_000944135.1.8904 WP_000944135.1.89125 WP_000944135.1.89262 WP_000944135.1.89439 WP_000944135.1.89874 WP_000944135.1.8990 WP_000944135.1.90239 WP_000944135.1.90269 WP_000944135.1.90514 WP_000944135.1.90661 WP_000944135.1.90994 WP_000944135.1.91184 WP_000944135.1.91287 WP_000944135.1.91629 WP_000944135.1.91969 WP_000944135.1.92259 WP_000944135.1.92849 WP_000944135.1.92897 WP_000944135.1.93186 WP_000944135.1.93316 WP_000944135.1.93435 WP_000944135.1.93567 WP_000944135.1.93690 WP_000944135.1.9392 WP_000944135.1.94319 WP_000944135.1.94324 WP_000944135.1.94325 WP_000944135.1.94992 WP_000944135.1.95008 WP_000944135.1.95154 WP_000944135.1.95281 WP_000944135.1.95307 WP_000944135.1.95495 WP_000944135.1.95505 WP_000944135.1.9563 WP_000944135.1.96200 WP_000944135.1.96261 WP_000944135.1.96368 WP_000944135.1.96412 WP_000944135.1.96577 WP_000944135.1.96613 WP_000944135.1.96688 WP_000944135.1.97295 WP_000944135.1.97928 WP_000944135.1.97999 WP_000944135.1.98322 WP_000944135.1.98419 WP_000944135.1.98510 WP_000944135.1.98512 WP_000944135.1.99183 WP_000944135.1.99459 WP_000944135.1.99524 WP_000944135.1.99759 WP_000944135.1.99862 gi|49484874|ref|YP_042098.1| gi|387144380|ref|YP_005732774.1| 282458.SAR2761 gi|532360718|ref|YP_008450547.1| gi|384871262|ref|YP_005753976.1| gi|384866393|ref|YP_005746589.1| gi|521213439|ref|YP_008169785.1| gi|554645592|ref|YP_008717383.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]