SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NCU03011T0 from Neurospora crassa OR74A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NCU03011T0
Domain Number 1 Region: 70-492,521-546
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.58e-46
Family Cystathionine synthase-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NCU03011T0
Sequence length 632
Comment | NCU03011 | Neurospora crassa OR74A (finished) hypothetical protein (633 aa)
Sequence
MSRLNLLSRLSKKGRERRDVTTMSDSTRKSSQEKTSSEYPALSSINFPFSGNKRLTPIES
PYNKPVEMIRKEEYSHMNSGIYLDHSGTTIYAQSTIKRFADKMRANLYGNPHSANEPAKF
SGEMVDSVREKTLRFLGADPRHFDLVFVANATAAIKLVADCFRDLAEQTRAGSFWYGYHR
DAHTSLVGVRELTKGPLSHKCFESDAEVEEWIEGRNTFGQQPGGLALFAYPGQSNLTGRR
LPLTWTGRIRHDRTKRLRNTYTLLDAAALAMTSPMSYVFEDPDTAPDFTCVSFYKIFGFP
DVGGLIVRKDSGHILALRKYFGGGTVSLVSTIGSAWHVSKGLEAYTHDDGSEHVGGLHEG
LEDGTLPFHSILALGEAIDVHKELFGSMENVSAHTSMLVKRLYQGMKAMRYENGQQLCKV
YHSGDEDLWEKGEGDKVYGDARVQGATIAFNVFREDGTYESYAMVEKMANDGGIYVRSGG
VCNPGGVFTALQYEPWQLNRAKSAGHHCGSNGLSVINELPTGVVRASLGAMSTAQDVNAF
LDFLKKNFLEKGLPTPKSNIKRKRQQAQNLLGSISSAAMATATVATNGETETGTGTSTVI
LPPSPIPTSVGEEGVVTMKPKVLGRVGSAISI
Download sequence
Identical sequences Q1K932 Q9P3Q6
XP_965397.3.24337 NCU03011T0 5141.NCU03011.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]