SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NCU06112T0 from Neurospora crassa OR74A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NCU06112T0
Domain Number 1 Region: 54-360,397-542
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.98e-105
Family Pyridoxal-dependent decarboxylase 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NCU06112T0
Sequence length 545
Comment | NCU06112 | Neurospora crassa OR74A (finished) glutamate decarboxylase (546 aa)
Sequence
MNGFHSTDKPLNRASEVDHLIDAVKSLIIPYIRDADNAASFRATGQLPPDNRNVLVKSLR
PDQLVKELALSLPSGEGQGSQGLLETIQSILSYSVNTWDQGFMDKLYASTNAVGVVTELL
LSVLNTNLHVYQVSPALSVIEKYTAKQFAALFGFTGPRAGGVTCQGGSASNLTSIVIARN
TLFPLSKLHGNGHEQCGAPGPLILLTSAHGHYSIEKAAMTCGFGSSAVWTVPVDEQGRMQ
PAALREMVLKAKSEGKHPFYVNATAGTTVLGSYDPFDEIADVCDEFGMWLHIDGSWGGPA
VFSKKHKHKMQGSHRARSLTVNPHKMLNAPVTCSFLLTNDVKVFHRANTLPAGYLFHGPA
AAEEEEDADGEENAPQSQTTPSEEGVTTTNGCGNGNTQDEVWDLADLTLQCGRRGDALKL
ALSWIYYGAAGFERQIDGAFDMAAYLANLIAERNDFVLVSSNPPPCLQVCFYYAPGGKLA
DEPQENTRRTRIMVEKLIARGFMVDYAPGDKGSLFRVVVNCQTLRGTVEGLVKGLEAIGK
EIVPQ
Download sequence
Identical sequences Q7S5H6
NCU06112T0 5141.NCU06112.1 XP_959974.1.24337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]