SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NCU06189T0 from Neurospora crassa OR74A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NCU06189T0
Domain Number 1 Region: 148-543
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.54e-103
Family GABA-aminotransferase-like 0.0000000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NCU06189T0
Sequence length 629
Comment | NCU06189 | Neurospora crassa OR74A (finished) 5-aminolevulinate synthase (630 aa)
Sequence
MDSVLRQSKAVCPFMKKATASSLRAMTTAARPAASPCGGAISKLQVLAHRCPVMGKAMAV
QSARTGGRASAAPASFVHKAKLHTGRPREAQAVEGVFTGQKAGLPPHPPVKPTTATAANP
SPAACTVSGNFGTKFNYEKFYENELEKKHKDKSYRYFNNINRLAKDFPRAHMATKEEKVA
VWCANDYLGMGRNKHVLEAMHTTLDEYGAGAGGTRNISGHNKHAVELENSLAKLHATDAA
LVFSSCYVANDATLATLGSKLPDCVILSDSLNHASMIQGIRHSGAKKIIFKHNDVEDLEK
KLAALPLHIPKIIAFESVYSMCGSIGPIEKFCDLAEKYGAITFNDEVHAVGMYGPHGAGV
AEHLDWEAHQRGETKGTIADRIDIYSGTLGKAYGCVGGYIAGSAKLVDTIRSLAPGFIFT
TTLPPAVMAGARAAIEYQMSYDGDRRLQQLHTRAVKEALADRDIPVIPNPSHIIPILVGN
AELAKKASDKLLNDHQIYVQSINYPTVPVGQERLRITPTPGHTKQFRDHLVAALDSIWTE
LGIKRTSDWAAEGGFIGVGEAEAEPVAPLWTDEQLGIADAVAELRAQASDEKKGVINQLL
ESVALEQEREALNAAEEVADAAKAAAASA
Download sequence
Identical sequences A0A0B0E8U7 Q7RVY5
NCU06189T0 XP_963001.2.24337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]