SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NCU06761T0 from Neurospora crassa OR74A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NCU06761T0
Domain Number 1 Region: 98-518
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.21e-114
Family Pyridoxal-dependent decarboxylase 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NCU06761T0
Sequence length 576
Comment | NCU06761 | Neurospora crassa OR74A (finished) sphingosine-1-phosphate lyase (577 aa)
Sequence
MPGTSRMPVSLRQSIDSVKRSRPRNPMQVLNLNVDLIRNIVFFLFLLRWTRRALWKLKGR
GLFGTLFELFTDARRILYGYFLRLPGVRTKVRAQIDDALTKMQAKMIPAGQTRYLSLPKE
GWTEEAVRKELEALATMDHTRWEDGYVSGAVYSGEDELLKLQTEAYGKFTVANPIHPDVF
PGVRKMEAEVVAMVLSLFNAPPGAAGVSTSGGTESILMAILSARQKAYHERGVTEPEMII
PETAHTAFRKAAEYFNIKLHLVACPAPTYQVDTKRVARLINRNTIMLVGSAPNFPHGIID
DISALSKLALRKKIPLHVDCCLGSFLVPFLDKAGFDSQPFDFRLKGVTSISCDTHKYGFA
PKGNSTVLYRTAELRSYQYFVDPSWSGGVYASPGIAGSRPGALIAACWASLMSVGEEGYL
KSCTQIVGATKKLAEHIRSHPTLQQELEILGNPLVSVLAFQARGDLNIYDIADGMSSRGW
HLNALQNPPAIHVAVTAPVAKNWERLAQDLEGVVEEEREKERVRQVEALKMGISGKTGKQ
KAAGDTAALYGVAGSLPNKSVVVDLARGFLDLLYKA
Download sequence
Identical sequences Q1K8S9 Q8X074
5141.NCU06761.1 NCU06761T0 XP_963533.1.24337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]