SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NCU06803T0 from Neurospora crassa OR74A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NCU06803T0
Domain Number 1 Region: 33-468
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.61e-129
Family Pyridoxal-dependent decarboxylase 0.0000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NCU06803T0
Sequence length 521
Comment | NCU06803 | Neurospora crassa OR74A (finished) glutamate decarboxylase (522 aa)
Sequence
MVHLTIIPKEDEIRDGLDIPLTGALKAVHLQLANDEDRFTTSVYGSKFAAADLPRHEMPD
EEMPKEVAYRMIKDELSLDGNPLLNLASFVTTYMEEEAEKLMTESLPKNFIDYEEYPQTA
DIQNRCVSMIGRLFNAPVKDAEASSAVGTSSVGSSEAIMLGVLAMKKRWKNKRIAEGKPA
DKPNLIMSSAVQVCWEKATRYFEVEEKFVYCTPDRYVIDPKETVDLVDENTIGICCILGT
TYTGEYEDVKAVNDLLVERGLDTPIHVDAASGGFVAPFVVPDLEWDFRLKNVVSINVSGH
KYGLVYPGVGWVVWRSAEYLPQELVFNINYLGADQASFTLNFSKGASQVIGQYYQLIRLG
KHGYRAIMSNLTRTADYLAESLAALGFIIMSQKSGQGLPLVAFRLKEDPDRTYDEFALAH
QLRVRGWIVPAYTMAPKTEGLKMLRIVVREDFSRNRCDGLISDIRSCQGILEQMDKETVK
KQQEFIHKHHVVSGKASHNHPKYHKEKHSLQGKTGKTHSIC
Download sequence
Identical sequences A0A0B0E3S9 Q7SCH4
NCU06803T0 XP_963644.2.24337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]