SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NCU08275T0 from Neurospora crassa OR74A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NCU08275T0
Domain Number 1 Region: 1-505
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.71e-119
Family Pyridoxal-dependent decarboxylase 0.0000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NCU08275T0
Sequence length 508
Comment | NCU08275 | Neurospora crassa OR74A (finished) aromatic-L-amino-acid decarboxylase (509 aa)
Sequence
MDSQDFREAAATAIDDIASYYDNLDDRNVVSTVEPGYLRKLLPSEAPVEGEAWTDIHKDI
EGKILPGITHWQHPGFHAFFPCATSFPSILGELYSAALSGACFNWICSPAVTELETIVLD
WLAKILGLPECYLSTGPTRGGGVIQGSASEAVLTAMVAARDKYLRETVPLEQFPEGSEAR
EDAIAHKRSKMVALATTATHSSTKKASIILGVRFHTIAVHADTGYSLTGPVLAKTLAELR
ARGLEPFFMTATMGTTDTCAVDDFAGIVSTLKSDPVHPAGTPGELWVHIDAAYAGSALVL
PSVREQVSISLIENFHSFDMNMHKWLLTNFDASCLFVRDRNWFIQALTINQAVYGNKASE
GGLVTDYREWQIPLGRRFRSLKIWFVLRNYGVKGLQSYISRTLKLGEEFADSLKSRPDLF
EILTGPNFALTVFRVAGKEQGKSDEELNALTKAVCEKINASGRMWVTSTVLDGRFAIRMV
TSVSTTEKEHVDRAWKILVEAAEEIVKA
Download sequence
Identical sequences A0A0B0DFV9 Q7S8J2
NCU08275T0 XP_961903.1.24337 5141.NCU08275.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]