SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|74316902|ref|YP_314642.1| from Thiobacillus denitrificans ATCC 25259

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|74316902|ref|YP_314642.1|
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.89e-31
Family Sfri0576-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|74316902|ref|YP_314642.1|
Sequence length 122
Comment hypothetical protein Tbd_0884 [Thiobacillus denitrificans ATCC 25259]
Sequence
MISLDVDQNLIAVTVMGQFTLADYREFEEAVAHGIAFEGKVNLLFDLRDMLSYSVDVAWE
ELKFSREHKNDFGRIAILTGDEWVAWSMWVNRMFMSADIRLFDELEAAQAWVTGGELPAP
VI
Download sequence
Identical sequences Q3SKE6
372233 gi|74316902|ref|YP_314642.1| 292415.Tbd_0884 WP_011311396.1.100243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]