SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|74318627|ref|YP_316367.1| from Thiobacillus denitrificans ATCC 25259

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|74318627|ref|YP_316367.1|
Domain Number 1 Region: 454-563
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000334
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|74318627|ref|YP_316367.1|
Sequence length 603
Comment sulfate anion transporter [Thiobacillus denitrificans ATCC 25259]
Sequence
MSLPAARSFPSWLKPFTSFRLWWPRVNRETTRADLMAGLTGALVALPQGVAFATIAGMPP
EYGLYAGMIPAIIAALFGSSWHLVSGPTTAASIVLFSVLSPHAEPGTAQYVSLALTLTFM
VGVIQIVMGLAKLGTLVNFISHSVVTGFTAGAAILIATNQVKHFTGQAIPRGASFSDTWS
HAFTHVDEIQVAIAATGLVTLLLGIAVKRWLPRLPYMIVAMLGGAVFGNAIARVLGVELP
TVGALPASLPPLSAPAFDAESVRAVASGVIAVTLLALTEAVSIARALAARSGQHVDGNQE
FVGQGMSNLAGAFFSGYVATGSFNRSGVNFAAGAKTPLAAILAGVFLLILVLFVAPWAQY
LPNAAMAGILFLVAWGLIDFDEIAHTFKTSRQETAIMAATFAATLFLTLEEAIIIGVLLS
LAIYLSRTSKPQLRVRAPNPHHKKRHFTDAENAPQCPQLRFVRIDGSLFFGATSHIRETL
AAQDQTAPDQKHVAIVAQGINFIDLAGAHYLAEEAERRRSQGGGLYFIRVKDTVQEQLAE
NGALKTIGGANLFDSKTEAIAALYKRLDPAVCSICRARIFRECQGRPAEQAVTPDLVMPV
SHA
Download sequence
Identical sequences Q3SFP4
WP_011313121.1.100243 gi|74318627|ref|YP_316367.1| 292415.Tbd_2609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]