SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TA10405 from Theileria annulata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TA10405
Domain Number 1 Region: 19-239
Classification Level Classification E-value
Superfamily ITPase-like 1.18e-36
Family Maf-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TA10405
Sequence length 249
Comment |||Maf-like protein, putative|Theileria annulata|chr 04|||Manual
Sequence
MEVYSVVGLRGLFSDPNKAWIVMATQSPHRPMIMKNHMRITNVLTMASGFEEDLSKDDYP
TGGDYSAATAENKARIVAKTIFTANDPESKKKVRTLLTNPFGELDKDFDVDKIQVVIGAD
TIADMNGTIYEKPVDREDARRQLSSYVESYHNIYTGVAMFARGRGYEVPEKKFYTTTKVK
YQKLSEEDINALLDTREHEGSAGSYRITGLAESLIEELVGSYTNVIGLPAQCVSSALCDL
AKSYNMFNF
Download sequence
Identical sequences Q4U8Y4
XP_953344.1.9581 5874.Q4U8Y4 gi|84997245|ref|XP_953344.1| TA10405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]