SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|87201164|ref|YP_498421.1| from Novosphingobium aromaticivorans DSM 12444

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|87201164|ref|YP_498421.1|
Domain Number 1 Region: 29-110
Classification Level Classification E-value
Superfamily SH2 domain 0.0000979
Family SH2 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|87201164|ref|YP_498421.1|
Sequence length 130
Comment hypothetical protein Saro_3152 [Novosphingobium aromaticivorans DSM 12444]
Sequence
MSQERLLSAALALFGVVFCLIYPLAMLWPSGWAWHEGHPAGNDYFMMIVGVYATLGVFLV
RASRAPAQHASLIWFTVWSSLVHAAIMAVQSMRTPMQHGHLYGDVPALVLVAVVLGALMP
RAGASRASAA
Download sequence
Identical sequences Q2G3I6
279238.Saro_3152 WP_011446791.1.26809 WP_011446791.1.96002 gi|87201164|ref|YP_498421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]