SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|87199039|ref|YP_496296.1| from Novosphingobium aromaticivorans DSM 12444

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|87199039|ref|YP_496296.1|
Domain Number 1 Region: 191-458
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 1.44e-55
Family Tricorn protease N-terminal domain 0.0077
Further Details:      
 
Domain Number 2 Region: 49-188
Classification Level Classification E-value
Superfamily TolB, N-terminal domain 6.28e-31
Family TolB, N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|87199039|ref|YP_496296.1|
Sequence length 461
Comment translocation protein TolB [Novosphingobium aromaticivorans DSM 12444]
Sequence
MKIRHLLLLAGLVSAPAIVAAQQTALPSSSAAQASGDDDGGLTGSVSDESEWQDLGIAIP
SFPTNASVPTAAEGGTTEALGRNVARVVFNDLKNNGLFKPVGPDALPAIAFPQVAAPAFD
AWRGRSAEMLVQGFVKANEDGRLTVGCYLYDVALGSELARQGYVVKPEEWRRAAHKCADM
VYSRLSGESPFFDSKIAYIAETGPKDRRRKQLAIMDSDGANHRFITNGQATALTPRYSPD
YSQIVYLSYLNGAPRIYIYNIGTGQQKLVTSSTNPTFAPRWSPDGKWILYSMSVAGNTDI
YRVSVNGGASTRLTDSPGIDVGGSYSPDGSRIVFESDRSGSQQLYVMNADGSNQKRISFF
GGRAATPEWSPRGDQIAFTHLGGNFRIAVTDPSGGNMRFLTDSWQDEAPTWSPNGRIVQF
FRTERGSGKTGIWQVDLTGRNERKLNTPVDGSDPAWGPVLP
Download sequence
Identical sequences Q2G9L1
279238.Saro_1017 WP_011444676.1.26809 WP_011444676.1.96002 gi|87199039|ref|YP_496296.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]