SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|87200776|ref|YP_498033.1| from Novosphingobium aromaticivorans DSM 12444

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|87200776|ref|YP_498033.1|
Domain Number 1 Region: 435-567
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.44e-32
Family Flavohemoglobin, C-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 326-425
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.97e-24
Family Ferredoxin reductase FAD-binding domain-like 0.00094
Further Details:      
 
Domain Number 3 Region: 553-666
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.06e-18
Family 2Fe-2S ferredoxin-related 0.013
Further Details:      
 
Domain Number 4 Region: 177-291
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.000000251
Family PNP-oxidase like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|87200776|ref|YP_498033.1|
Sequence length 675
Comment oxidoreductase FAD/NAD(P)-binding [Novosphingobium aromaticivorans DSM 12444]
Sequence
MDDTQRVANSPIWHEGERALQAHVGVVDRMGEVGARVIRPFMPDQHRTFYAQLPFVILGS
VDAEGAAWATVVEGEPGFLSSPDPKSLVLGALPHADDPALGGIHDEAALGLLGIELHNRR
RNRVNGTLRFPSAGAPLLEVGQSFGNCPQYIQLRDATLSRAPAAPPPHLAEELPALDAAA
RAMIGSADTLFVASYADRLDSGRQVDVSHRGGKAGFVRVDAEGKLTIPDFAGNLFFATLG
NVLLNGQAGLVFIDFESGDLLQMSGKAEVVLDSPEIASFAGAERLWTFVPQRIVRRKGAL
ALRWSFRDNGWSPNSLATGQWPAALHWQQLRVERIVAESASIRSFHLRPVSPDLGWQHEA
GQHLPIRVRLPGEDSPAVRTYTLSSAPSDPLYRISVKREGKVSAWLHEQVREGDIIEARA
PAGSFVIEPGAPRLAVLIGAGIGITPMISMLRELVSLGANGAPARPAVLIQSARSLAERA
FANELASLADRVRVVRVLGDAKGAQAGADYDLEGRIDLQLLSAVLPFGDHDFYLCGPKGF
MQAIYDALRGANVPDHRIHAEAFGPSSLVRRRDTTRETAPAAQPSAVPVPVLFTASLKEA
RWKPGEGTLLELAEARGLKPEFGCRSGSCASCKVKLVSGAVAYPRTPSAEVASGEVLLCC
AVPAEGNDKPLQVEA
Download sequence
Identical sequences Q2G4M4
279238.Saro_2763 WP_011446403.1.26809 WP_011446403.1.96002 gi|87200776|ref|YP_498033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]