SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|488651430|ref|YP_007923234.1| from Streptococcus oligofermentans AS 1.3089

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488651430|ref|YP_007923234.1|
Domain Number 1 Region: 52-182
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 7.32e-19
Family PA2201 C-terminal domain-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488651430|ref|YP_007923234.1|
Sequence length 186
Comment hypothetical protein I872_04950 [Streptococcus oligofermentans AS 1.3089]
Sequence
MKDYLEVHYQFLVLFNEELVKLSYSIGASKEEIFPYYQGILSNLKLIASEGVSFYRAVDV
FALGVLYSERKEEFLDDLKDIYAQMDHTDGLIEYYMVYLFHDKIVPFHSILEYQNMIEDT
YESVAKAQGFWYYSHSDAPWYNNHTKDTYVGYWSFDTAATCKIKGIYDERLKDLEYFPYD
LLVQGK
Download sequence
Identical sequences N0C628
gi|488651430|ref|YP_007923234.1| WP_015605045.1.8374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]