SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488652465|ref|YP_007924269.1| from Streptococcus oligofermentans AS 1.3089

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488652465|ref|YP_007924269.1|
Domain Number 1 Region: 93-242
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 3.27e-44
Family PA2201 C-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488652465|ref|YP_007924269.1|
Sequence length 248
Comment hypothetical protein I872_10215 [Streptococcus oligofermentans AS 1.3089]
Sequence
MAIRDTLSTKKDYKDGLMSNKEALQYFQEKLIKLQIDLDNGIENYKKPTIEVYHSTLATI
LSYQRDILFATYSSGASLLVFKEEYISFVACLVPVWHKGWGYEQMVWALSIGILLEIDEE
IFEQLVDLVKKDDPEDYLIDYLIQYRHPAWKIRINYNFPRPYGFTRKIIEEENSEQALKR
LQEYLTKKWYQGSRDAGWYDLHKQNVKNHVGYWSFESGAICKIKGLNYKELEEIPYFPYD
LVAERAEV
Download sequence
Identical sequences N0C923
gi|488652465|ref|YP_007924269.1| WP_015606004.1.8374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]