SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488651184|ref|YP_007922988.1| from Streptococcus oligofermentans AS 1.3089

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488651184|ref|YP_007922988.1|
Domain Number 1 Region: 1-209
Classification Level Classification E-value
Superfamily CutC-like 2.22e-62
Family CutC-like 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488651184|ref|YP_007922988.1|
Sequence length 210
Comment copper homeostasis protein CutC [Streptococcus oligofermentans AS 1.3089]
Sequence
MIYEFCAENVTLLDKALKAGAKRVELCDNLSVGGTTPSYGVIEAAVRIVQPYDATVMTMI
RPRGGNFVYSDMEIEIMLSDIQKAREAGSHGLVFGVLTENNEIDYPKMERLLEAARGLDV
VFHMAFDAIPAEYQFGELDWLVEHGVKRILTHGGPASESILEHLAWLDELIEHAAGRIEI
LPGGGINLENRAEIADTLGVDQLHGTKVVF
Download sequence
Identical sequences N0C718
WP_015604809.1.8374 gi|488651184|ref|YP_007922988.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]