SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488651420|ref|YP_007923224.1| from Streptococcus oligofermentans AS 1.3089

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488651420|ref|YP_007923224.1|
Domain Number 1 Region: 1-374
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.51e-93
Family Cystathionine synthase-like 0.000000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488651420|ref|YP_007923224.1|
Sequence length 378
Comment class-V aminotransferase [Streptococcus oligofermentans AS 1.3089]
Sequence
MIYLDNSATTNPYPEALATYTEVASKIWGNPSSLHSLGSQATRLLEASRRQIAELLGKSS
SEIFFTSGGTEGDNWVLKGVAFEKIPFGKHIIVSNIEHPAVKESALWLQNQGFEVDFAPV
DKAGFVDVDKLAELIRPDTTLVSIMAVNNEIGSIQPIQKISELLADKPTISFHVDAVQAV
TKIPTAAYLTDRVDFATFSSHKFHGLRGVGFVYIKSGKKISPLLTGGGQESDKRSTTENL
AGIAATAKALRLSMEKQEVFAQRTAQMKAIILEELQKYPDVVIFSDMEDFAPHILTFGIK
GVRGEVVVHAFEDYEIYISTTSACSSKAGKPAGTLIAMGVEKFLAQTAVRISLDADNDMS
QIEQFLTTFKIIYEKPEK
Download sequence
Identical sequences N0C621
gi|488651420|ref|YP_007923224.1| WP_015605035.1.8374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]