SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488651685|ref|YP_007923489.1| from Streptococcus oligofermentans AS 1.3089

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488651685|ref|YP_007923489.1|
Domain Number 1 Region: 3-361
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.61e-106
Family GABA-aminotransferase-like 0.0000000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488651685|ref|YP_007923489.1|
Sequence length 363
Comment 3-phosphoserine/phosphohydroxythreonine aminotransferase [Streptococcus oligofermentans AS 1.3089]
Sequence
MTIYNFSAGPAVLPKEVLKKAQAEFLDYAQSGMSVMELSHRSKEFDDIIKEAESLLRELM
AIPDNYRVLFLQGGASTQFSMIPLNLAKGGKAYYLVAGSWGKKAYTEAVKLAKTVPFEPI
LLASSEDLNYTEIPSFDEKEIDPQAAYVHLTTNNTIEGTAIYDLPATNGVPIVADMSSNI
LAAQYRVEDFGLIYAGAQKNIGPAGVTVVIIREDLLDDEPVLSSMLDYRIQADNGSLYNT
PPTFAIYMAKLVFEWVKELGGVAEMEKLNREKSGLLYDFIEQSDFYRSPVRYKEQRSVAN
IPFVSPSPELDAKFNKEAAAAGFKNIKGHRSVGGMRASLYNAFPLQGVKDLIAFMQKFEE
ENS
Download sequence
Identical sequences N0C6Q7
WP_015605295.1.8374 gi|488651685|ref|YP_007923489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]