SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|104037|e_gw.71.212.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Nemve1|104037|e_gw.71.212.1
Domain Number - Region: 25-94
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00602
Family MgtE N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|104037|e_gw.71.212.1
Sequence length 98
Sequence
TTPEAFKPSEALWVVEALISSETLSVVEALISSEALSVVEALMPSETLSVVEALMPREAL
SVVEAFTPSEALSVVEALMPSETLSVVEAFTPSEALSV
Download sequence
Identical sequences A7S4B4
XP_001633553.1.94760 45351.JGI104037 jgi|Nemve1|104037|e_gw.71.212.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]