SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|112961|e_gw.115.68.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|112961|e_gw.115.68.1
Domain Number 1 Region: 95-216
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 8.67e-21
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00019
Further Details:      
 
Domain Number 2 Region: 9-90
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 1.11e-17
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|112961|e_gw.115.68.1
Sequence length 217
Sequence
FQLIKSRYEAEGEKHETDEFLKPIIIDKEGQIKDGDTICFFDFRADRMRQINEAIGVKPP
FETDVIPKDLYHITMTQYKKEFPFPCLFPPVVPKNVLAEWLDVQKVPQYHCAETEKYAHV
TFFFNGGVEKKFDLEDRMLVPSPKVPTYDLLPPMSSQGVADEVTILEMFILDKAIGQIYQ
TCQKQNYTLMVTSDHGNAEQMISEQGGPHTAHTTNRG
Download sequence
Identical sequences A7SC83
XP_001630777.1.94760 jgi|Nemve1|112961|e_gw.115.68.1 45351.JGI112961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]