SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|155148|e_gw.8175.1.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|155148|e_gw.8175.1.1
Domain Number 1 Region: 89-174
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 1.31e-17
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00082
Further Details:      
 
Domain Number 2 Region: 5-89,129-151
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.00000000000209
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|155148|e_gw.8175.1.1
Sequence length 175
Sequence
MAEVKNKVCLIVIDGWGICEKKEGKVMLSVIGNAIYHGETPVMDAFAEGKGCAYTSLDAS
GLSVGLPAGLMGNSEVGHLNIGAGRVVYQDIVRINMTSEGHTFHENETLSAAAERAKKTA
GSTQMTFQVTYVQQVIDKLKELNYGSLAAIMGRYYAMDRDKRWERVKIAYEALVQ
Download sequence
Identical sequences A7TCQ3
45351.JGI155148 XP_001618262.1.94760 jgi|Nemve1|155148|e_gw.8175.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]