SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|207204|fgenesh1_pg.scaffold_78000006 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Nemve1|207204|fgenesh1_pg.scaffold_78000006
Domain Number - Region: 70-144
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 0.011
Family L,D-transpeptidase catalytic domain-like 0.011
Further Details:      
 
Domain Number - Region: 248-317
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 0.0225
Family L,D-transpeptidase catalytic domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|207204|fgenesh1_pg.scaffold_78000006
Sequence length 360
Sequence
MSLMKIALIGCLLVLVRSDVPSCCPENKSPSGGPSKNPKAVVCKFERSLLSLTCVKGKSS
QTCNVVKATGEKESDQKGPTPYGEYLIGNYHTSTSYSGLDWYNLYPKKEDNSGYYGYWSA
NKLGRSTMGLHPGRVSWGCVTVDASNCNSGGYDCYNKDSCWKKIKKIVSSGSMTYRKSTY
SGILYVIAQLMAQELQKRSTINVSTAQGRKGWVRGVAINKAFDFYDSCMGKSSQTCNVVK
ATGEKESDQKGPTPYGEYLIGNYHTSTSYSGLDWYNLYPKKEDNSGYYGYWSANKLGRST
MGLHPGRVSWGCVTVDASNCNSGGYDCYNKDSCWKKIKKIVSSGSMTYRKSTYSGILYVV
Download sequence
Identical sequences A7S5P7
jgi|Nemve1|207204|fgenesh1_pg.scaffold_78000006 45351.JGI207204 XP_001633004.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]